Recombinant NADH-ubiquinone oxidoreductase chain 3 (NAD3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant NADH-Ubiquinone Oxidoreductase Chain 3

NADH-ubiquinone oxidoreductase chain 3 (ND3), also known as MT-ND3 when referring to its mitochondrial encoding, is one of the fundamental components of mitochondrial Complex I. Complex I (NADH:ubiquinone oxidoreductase) serves as the initial enzyme in the respiratory electron transport chain within mitochondria . This complex plays a pivotal role in oxidative phosphorylation, the process through which cells generate adenosine triphosphate (ATP), the primary energy currency of cellular functions .

Mammalian Complex I consists of 45 distinct subunits: fourteen "core" subunits that have been conserved throughout evolution from bacteria to humans and are sufficient for catalytic activity, along with 31 "supernumerary" subunits that support assembly, stability, regulation, or fulfill independent metabolic roles . As one of these core subunits, ND3 is encoded by the mitochondrial genome rather than the nuclear genome, highlighting its evolutionary significance and essential nature .

The recombinant form of ND3 refers to the protein produced through recombinant DNA technology, enabling the synthesis of specific proteins outside their natural biological context. Several species-specific variants have been developed, including recombinant ND3 from Nelsonia neotomodon (a rodent species) . These recombinant proteins serve as valuable tools for investigating complex I structure, function, and potential therapeutic interventions for mitochondrial disorders.

Function and Biochemical Properties

The primary function of Complex I, in which ND3 plays an essential role, is to catalyze the transfer of electrons from NADH to ubiquinone while simultaneously pumping protons across the inner mitochondrial membrane . This process is fundamental to establishing the proton gradient that drives ATP synthesis through ATP synthase.

The functional mechanisms associated with Complex I, and by extension ND3, include several key biochemical properties:

Electron Transfer Pathway

Complex I removes electrons from NADH and channels them through a series of enzyme-bound redox centers, including flavin mononucleotide (FMN) and iron-sulfur (Fe-S) clusters, ultimately delivering them to the electron acceptor ubiquinone . This electron transfer represents the initial step in the respiratory chain that ultimately leads to oxygen reduction and water formation.

Proton Translocation

For each pair of electrons transferred from NADH to ubiquinone, Complex I typically translocates four protons from the mitochondrial matrix to the intermembrane space . This proton-motive force (PMF) supports both ATP synthesis and the transport of various metabolites across the mitochondrial membrane .

Reversibility of Reactions

When the PMF is sufficiently high relative to the potential difference between the NAD+ and ubiquinone pools, Complex I can operate in reverse, reducing NAD+ with ubiquinol, driven by the existing PMF . This reversibility demonstrates the enzyme's adaptability to different cellular energy states.

Additional Catalytic Activities

Beyond its primary function, Complex I can catalyze NADPH oxidation, albeit at significantly lower rates than NADH oxidation . Additionally, it serves as an important source of reactive oxygen species in mitochondria, with superoxide produced when molecular oxygen reacts with the reduced FMN in the active site where NADH oxidation occurs .

The kinetic parameters related to these activities have been extensively studied and are presented in Table 1:

Substrate/ProductKM (mM)kcat (s-1)kcat/KM (s-1 M-1)KOx (mM)KRed (mM)
NADH0.094 ± 0.012700 ± 2002.9 × 107-0.16-0.26
NAD+>0.020>1.6(5.0−80) × 103≫0.11-
NADPH2.0−4.613−22(3.0-6.5) × 103-≫0.090
NADP+>0.14>0.24(0.50−1.7) × 103≫0.015-
APADH0.15 ± 0.02150 ± 201.00 × 106--
APAD+0.19−0.54290−460(0.78−1.7) × 1062.8−12.5-
ThioNADH0.055−0.1529−46(1.2−5.2) × 106-0.018−0.20
ThioNAD+0.15−0.32180-230(0.7−1.3) × 1060.27−0.45-

While these functions are attributed to Complex I as a whole, ND3, as one of the core subunits, is essential for these processes. The specific role of ND3 within the complex likely relates to maintaining the structural integrity of the membrane domain and possibly to facilitating the coupling mechanism between electron transfer and proton translocation.

Production and Recombinant Technology

The production of recombinant NADH-ubiquinone oxidoreductase chain 3 employs advanced molecular biology techniques, although the search results do not provide exhaustive details about specific production methods. The existence of recombinant ND3 products from various species, including Nelsonia neotomodon, confirms that these proteins have been successfully produced using recombinant technologies .

The production process for recombinant ND3 likely encompasses several critical steps:

  1. Isolation of the gene encoding ND3 from the mitochondrial genome of the source organism

  2. Cloning of this gene into an appropriate expression vector with suitable regulatory elements

  3. Transformation or transfection of a host organism (commonly bacteria, yeast, or mammalian cell lines) with the expression vector

  4. Controlled induction of protein expression in the host organism

  5. Purification of the recombinant protein through techniques such as affinity chromatography, ion exchange chromatography, or gel filtration

The hydrophobic nature of ND3 as a membrane protein presents significant challenges for recombinant expression and purification. Special methodologies, including the use of detergents, lipid nanodisc systems, or specialized membrane-mimetic environments during purification, may be necessary to maintain the protein's native structure and functional properties.

Commercial recombinant ND3 products, such as those from MyBioSource.com for Nelsonia neotomodon, are available for research applications . These products enable investigators to study the properties of ND3 from different species without the need for complex isolation procedures from natural sources.

Research Applications and Findings

Research utilizing recombinant ND3 and studies of Complex I have yielded significant findings about the structure, function, and mechanisms of this important component of the mitochondrial respiratory chain.

Transhydrogenation Studies

Investigations into the transhydrogenation reactions catalyzed by Complex I have provided valuable insights into the mechanism by which the complex transfers hydride between different nucleotide pairs . These studies have revealed:

  1. Complex I can facilitate hydride transfers between reduced and oxidized nicotinamide nucleotides, employing four different nucleotide pairs encompassing a range of reaction rates.

  2. The experimental data from these reactions conform accurately to a ping-pong mechanism with double substrate inhibition, challenging previous mechanistic models.

  3. The findings strongly suggest that Complex I contains only one functional nucleotide binding site, contradicting earlier theories that proposed two different binding sites for the two half reactions .

These studies have generated valuable kinetic and thermodynamic information about nucleotide binding and interconversion in Complex I, which enhances our understanding of the mechanisms of coupled NADH oxidation and NAD+ reduction, as well as the control of superoxide formation by the reduced flavin .

Interaction with Inhibitors

The interactions between Complex I and various inhibitors provide valuable insights into the structural and functional properties of the complex and potentially of ND3 specifically. The most detailed information available concerns the interaction with piericidin A, a substrate-like inhibitor.

The cryo-EM structure of Complex I from mouse heart mitochondria with bound piericidin A has revealed intricate details about the inhibitor binding mode:

  1. Piericidin A binds competitively against the native ubiquinone-10 substrate in the active site.

  2. The piericidin isoprenoid-like tail aligns along the proposed ubiquinone-binding channel, overlapping with the predicted positions of the first three isoprenoid units of the natural substrate .

  3. This tail region is surrounded by multiple hydrophobic sidechains, including NDUFS7 Phe86 engaged in a π–π interaction and NDUFS2-Phe167 and Phe168 framing the final isoprenoid-like unit .

  4. The sidechains of NDUFS7-Thr59 and ND1-Glu204 are positioned near the hydroxy group on the piericidin chain, though at distances too great to form hydrogen bonds .

  5. Glu204, located on the TMH5-6 loop of ND1, marks the beginning of the "E-channel" that connects the ubiquinone-binding site to charged residues in the membrane domain, potentially playing a role in proton translocation .

Functional studies using proteoliposomes with varying ubiquinone concentrations have shown that both the apparent KM and Vmax values decrease with increasing piericidin concentration, contrary to the behavior typically expected from a competitive inhibitor (which would normally show increasing KM and constant Vmax) . This unexpected kinetic behavior suggests complex interactions between the inhibitor, the substrate, and the enzyme.

While the search results do not specify direct interactions between piericidin A and ND3, the positioning of ND3 near the ubiquinone binding site suggests that this subunit may influence or be affected by inhibitor binding, particularly considering that loops from ND1 and ND3 are associated with this region and may move during catalysis .

Physiological and Clinical Significance

The physiological and clinical importance of ND3 derives from its essential role within Complex I, which is central to cellular energy production and respiratory function.

Role in Energy Production

As a component of Complex I, ND3 contributes to the fundamental process of oxidative phosphorylation in mammalian cells. The complex captures free energy from oxidizing NADH and reducing ubiquinone to drive protons across the mitochondrial inner membrane, thereby powering ATP synthesis . This energy conversion process is essential for normal cellular function across all tissues, but particularly in energy-demanding organs such as the brain, heart, and skeletal muscle.

Involvement in Mitochondrial Diseases

Complex I dysfunction resulting from mutations in its subunits, including potentially ND3, is associated with a diverse range of inherited neuromuscular and metabolic diseases . While the search results do not specify ND3-specific pathologies, as an essential component of Complex I, mutations or alterations in ND3 could potentially contribute to these conditions.

The clinical manifestations of Complex I deficiencies typically include:

  1. Neurological symptoms such as leigh syndrome, encephalopathy, and seizures

  2. Myopathies and exercise intolerance

  3. Metabolic acidosis

  4. Cardiomyopathies

  5. Developmental delays and regression

Role in Oxidative Stress

Complex I is a significant source of reactive oxygen species (ROS) in mitochondria, with superoxide produced when molecular oxygen reacts with the reduced FMN in the active site where NADH is oxidized . This ROS production contributes to oxidative stress, which has been implicated in aging and various pathological conditions. As a component of Complex I, ND3 may indirectly influence this process, though its specific role in ROS generation is not detailed in the search results.

The development of recombinant ND3 provides a valuable tool for investigating these physiological and pathological processes, potentially leading to improved understanding and therapeutic approaches for mitochondrial disorders.

Future Research Directions

Based on the current state of knowledge about recombinant ND3 and Complex I, several promising avenues for future research can be identified:

Species-Specific Variations

The availability of recombinant ND3 from different species, such as Nelsonia neotomodon , provides an opportunity to investigate species-specific variations in structure and function. Comparative studies could reveal evolutionary adaptations and conserved features critical for function.

Therapeutic Applications

Investigation of potential therapeutic strategies targeting ND3 or its interactions within Complex I could lead to novel approaches for treating mitochondrial diseases. Recombinant ND3 could serve as a valuable tool for screening potential drug candidates or developing specific antibodies for diagnostic purposes.

Role in Disease States

Further research into the potential involvement of ND3 mutations or dysfunctions in specific mitochondrial diseases could improve our understanding of the pathophysiology of these conditions and potentially lead to targeted interventions.

Interaction with Other Mitochondrial Components

Studies exploring the interactions between ND3 and other components of the mitochondrial respiratory chain could provide insights into the integrated function of the respiratory complexes and potential regulatory mechanisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Prototheca wickerhamii
Target Names
NAD3
Target Protein Sequence
MYEFLGILIYFFIALALSLLLLGLPFLVSTRKADPEKISAYECGFDPFDDARGRFDIQFY LVAILFIIFDLEVAFLFPWALTLNKIGYFGFWSMMLFLFILTVGFIYEWRKGALDWS
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 and what is its biological role?

NADH-ubiquinone oxidoreductase chain 3 (NAD3/ND3/MT-ND3) is a critical subunit of Complex I of the mitochondrial respiratory chain. It is encoded by the mitochondrial genome and plays an essential role in the electron transport chain by facilitating the transfer of electrons from NADH to ubiquinone (coenzyme Q) . This process is coupled with the pumping of protons across the inner mitochondrial membrane, which generates an electrochemical gradient that drives ATP synthesis . In certain bacterial species like Pseudomonas aeruginosa, the NQR complex (which contains similar functional domains) couples electron transfer with ion translocation across the cell membrane, generating gradients that drive essential cellular processes .

The specific function of NAD3 has been characterized in various organisms, with notable differences observed. For instance, in P. aeruginosa, the NQR complex has evolved to function as a proton pump rather than a sodium pump, which is found in NQR homologues from other bacterial species .

How is NAD3 conserved across different species?

Post-transcriptional modifications, particularly RNA editing, can differ between variants within the same species. For example, in carrots, some C to U conversions in nad3 transcripts are specific to fertile lines, demonstrating that editing patterns can be variety-specific even when they don't affect the encoded amino acids .

What are the standard methodologies for studying NAD3?

Several methodologies are employed to study NAD3 depending on the research objectives:

For protein detection and quantification:

  • Sandwich ELISA: Two-site sandwich ELISA kits are commercially available to quantitate MT-ND3 in various samples .

  • Western blotting: Using specific antibodies against NAD3 for protein expression analysis.

For functional analysis:

  • Complex I activity assays: Measuring NADH oxidation rates in isolated mitochondria or membrane fractions.

  • Homology modeling and molecular dynamics simulations: Used to study structural aspects that determine cation selectivity and functional properties .

For genetic and expression analysis:

  • RT-PCR and RNA sequencing: For studying gene expression and RNA editing patterns in nad3 transcripts .

  • Site-directed mutagenesis: To study the effects of specific mutations on protein function.

How does NAD3 function relate to NAD+/NADH balance in cancer research?

Research has established critical connections between mitochondrial complex I (which contains NAD3) activity, NAD+/NADH balance, and cancer progression. Studies indicate that mitochondrial complex I is critical for defining aggressive phenotypes in breast cancer cells . Enhanced mitochondrial complex I activity has been shown to inhibit tumor growth and metastasis through regulation of:

  • Tumor cell NAD+/NADH redox balance

  • mTORC1 activity

  • Autophagy processes

Conversely, nonlethal reduction of NAD+ levels (by interfering with nicotinamide phosphoribosyltransferase expression) renders tumor cells more aggressive and increases metastasis . This research highlights the therapeutic potential of normalizing the NAD+/NADH balance to inhibit metastasis and prevent disease progression in breast cancer.

What methods are used to measure NAD3 function in relation to NAD+/NADH balance?

Researchers employ several techniques to assess NAD3 function and NAD+/NADH balance:

Biochemical assays:

  • NAD+/NADH quantification kits: To measure the ratio in cell extracts

  • Spectrophotometric assays: To measure complex I activity

  • Oxygen consumption measurements: Using respirometry to assess mitochondrial function

Advanced imaging techniques:

  • Fluorescence lifetime imaging: To monitor the NAD+/NADH ratio in living cells

  • Genetically encoded biosensors: To visualize NAD+/NADH changes in real-time

Molecular biology approaches:

  • RNA interference or CRISPR-Cas9 gene editing: To modulate NAD3 expression

  • Overexpression systems: For structure-function studies of modified NAD3 proteins

How can recombinant NAD3 be produced and characterized?

Production of recombinant NAD3 involves several steps and considerations:

  • Expression system selection: Due to the hydrophobic nature of NAD3, specialized expression systems are required. E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression are often used .

  • Vector design: Incorporation of appropriate tags (His, GST, etc.) for purification while ensuring they don't interfere with protein folding.

  • Solubilization and purification: Membrane proteins like NAD3 require detergents for solubilization. Common detergents include n-dodecyl-β-D-maltoside (DDM) or digitonin.

  • Functional characterization: Activity assays measuring electron transfer or proton pumping capabilities.

  • Structural analysis: Techniques such as circular dichroism, cryogenic electron microscopy, or X-ray crystallography can be used to determine protein structure.

Commercial recombinant NAD3 proteins from various species (e.g., Oncorhynchus mykiss) are available for research purposes , which can serve as controls or standards in experimental setups.

How does RNA editing affect NAD3 function in different organisms?

RNA editing is a critical post-transcriptional modification process that can alter the genetic message of NAD3. Studies in carrot (Daucus carota) have revealed specific patterns of C to U conversions in nad3 transcripts:

  • Three C to U conversions were specifically found in the fertile line but not in cytoplasmic male sterile (CMS) lines .

  • While these edits were different between variants, they resulted in silent modifications that did not affect the encoded amino acids .

RNA editing of NAD3 transcripts may serve regulatory functions even when not changing protein sequences. The editing patterns could be markers of different physiological states or developmental stages of the organism.

Table 1: RNA Editing Patterns in NAD3 Transcripts from Carrot

PositionCMS CarrotFertile CarrotEffect on Protein
Position 1CUSilent (no amino acid change)
Position 2CUSilent (no amino acid change)
Position 3CUSilent (no amino acid change)

What techniques are employed to study NAD3 transcript modifications?

Several methods are used to investigate NAD3 transcript modifications:

  • RT-PCR and Sanger sequencing: The most direct approach involves amplifying NAD3 cDNA and comparing its sequence with the corresponding genomic DNA to identify editing sites.

  • High-throughput RNA sequencing: RNA-Seq can identify editing events across the entire transcriptome, allowing for comprehensive analysis of NAD3 editing patterns.

  • Site-specific editing analysis: Using specific primers designed to distinguish between edited and non-edited sites.

  • Comparative analysis: Comparing sequences from different tissues, developmental stages, or physiological conditions to understand the biological significance of editing.

What is the connection between NAD3 mutations and human diseases?

Mutations in mitochondrial DNA, including those affecting complex I components like NAD3, have been associated with various diseases:

  • Cancer progression: Mutations affecting complex I and oxidative phosphorylation are found in breast tumors and may facilitate metastasis .

  • Mitochondrial disorders: NAD3 mutations have been linked to mitochondrial disorders characterized by complex I deficiency, which can manifest as neurological conditions, cardiomyopathies, or multisystemic disorders.

  • Age-related diseases: As NAD+ levels decline with age, dysfunction in NAD3 and other complex I components may contribute to age-related pathologies.

How can NAD+ precursors be used therapeutically in relation to NAD3 function?

Research suggests that enhancement of the NAD+/NADH balance through treatment with NAD+ precursors can have significant therapeutic effects:

  • Cancer treatment: Administration of NAD+ precursors has been shown to inhibit metastasis in xenograft models, increase animal survival, and strongly interfere with oncogene-driven breast cancer progression in the MMTV-PyMT mouse model .

  • Novel approaches: The development of compounds like NAD3 (a patent-pending complex containing Wasabia japonica extract, theacrine, and copper (I) niacin chelate) aims to improve NAD+ status without directly using precursors .

  • Mechanism of action: These approaches may work by upregulating enzymes that boost the conversion of NAD+ precursors to NAD+, while suppressing the activity of proteins that deplete and consume NAD+ .

How can computational methods enhance NAD3 functional studies?

Computational approaches have become essential tools in NAD3 research:

  • Homology modeling: Used to predict the structure of NAD3 based on known structures of homologous proteins. This approach has been valuable in understanding the functional characteristics of P. aeruginosa NQR .

  • Molecular dynamics simulations: These have been employed to understand how cation selectivity could be determined by the exit ion channels in respiratory complexes .

  • Comparative analysis: Used to identify specific residues that confer resistance to inhibitors, such as the resistance of P. aeruginosa NQR to the inhibitor 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO) .

  • Docking studies: To predict interactions between NAD3 and potential ligands or inhibitors.

What are emerging technologies for studying NAD3 in live cells?

Several cutting-edge technologies are being applied to study NAD3 function in live cells:

How does the NAD3 supplement complex differ from natural NAD3?

It's important to clarify that the NAD3 supplement represents a different entity from the mitochondrial NAD3 (NADH-ubiquinone oxidoreductase chain 3):

  • Composition: The NAD3 supplement is a patent-pending complex containing Wasabia japonica extract, theacrine, and copper (I) niacin chelate , while mitochondrial NAD3 is a protein subunit of complex I in the respiratory chain.

  • Mechanism: The NAD3 supplement is designed to improve NAD+ status by "upregulating enzymes that boost the conversion of NAD+ precursors" and "suppressing the activity of proteins that deplete and consume NAD+" . This differs from the natural NAD3 protein's role in electron transport.

  • Research focus: Studies on the NAD3 supplement examine "cellular aging markers in humans, cells, and other models" , while research on mitochondrial NAD3 typically focuses on its role in energy metabolism and disease.

What experimental designs are used to evaluate NAD3-targeting therapeutics?

Researchers employ various experimental approaches to evaluate NAD3-targeting therapeutics:

  • In vitro cell culture models:

    • Measurement of NAD+/NADH ratios before and after treatment

    • Assessment of mitochondrial function parameters

    • Analysis of gene expression changes in longevity-related pathways

  • Animal models:

    • Xenograft models to study effects on cancer metastasis

    • The MMTV-PyMT mouse model for breast cancer progression

    • Aging models to assess lifespan and healthspan effects

  • Human studies:

    • Measurement of biomarkers of cellular aging

    • Analysis of epigenetic changes

    • Assessment of NAD+ metabolism

  • Therapeutic efficacy metrics:

    • Inhibition of metastasis

    • Increase in animal survival

    • Interference with oncogene-driven cancer progression

    • Improvements in cellular NAD+ status

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.