Recombinant NADH-ubiquinone oxidoreductase chain 3 (nd3)

Shipped with Ice Packs
In Stock

Description

Fundamental Aspects of NADH-ubiquinone Oxidoreductase Chain 3

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a subunit of respiratory chain Complex I, encoded by the mitochondrial genome (MT-ND3 gene in humans). It belongs to a group of highly hydrophobic proteins that form the core of the transmembrane region of Complex I, the largest of the five complexes in the electron transport chain . The MT-ND3 gene in humans is located in mitochondrial DNA spanning from base pair 10,059 to 10,404 . This gene produces a protein of approximately 13 kDa composed of 115 amino acids .

ND3 functions as one of seven mitochondrially encoded subunits of NADH dehydrogenase (ubiquinone), along with MT-ND1, MT-ND2, MT-ND4, MT-ND4L, MT-ND5, and MT-ND6 . These subunits collectively participate in the minimal assembly of core proteins required to catalyze NADH dehydrogenation and electron transfer to ubiquinone (coenzyme Q10) . The structural integrity and proper functioning of ND3 are critical for maintaining efficient electron transport and preventing excessive production of reactive oxygen species.

Evolutionary Conservation and Variation

  • The highly conserved cysteine in position 39 is replaced by serine in Escherichia coli and Thermus thermophilus

  • An extra nucleotide phenomenon observed in the MT-ND3 gene from many species of birds and turtles, which is not translated to protein

These variations provide valuable insights into the evolutionary adaptations of mitochondrial function across different taxonomic groups.

Critical Functional Regions

A particularly significant structural feature is the hydrophilic loop connecting the first two transmembrane helices, which contains the highly conserved cysteine-39 residue . This loop is proposed to connect the ND3 subunit of the membrane arm with the PSST subunit of the peripheral arm of Complex I, placing it in a region critical for the catalytic mechanism . Mutations in three positions of this loop have been reported to cause Leigh syndrome, underscoring its functional importance .

Function and Role in Complex I

ND3 serves as an integral component of NADH:ubiquinone oxidoreductase (Complex I), which constitutes the largest complex of the respiratory chain. This complex catalyzes the first step of the electron transport chain by oxidizing NADH and transferring electrons to ubiquinone .

Active/Deactive Transition Mechanism

A particularly notable aspect of ND3 function involves its role in the active/deactive transition of Complex I. This reversible process occurs when the complex is incubated at temperatures between 30–37°C . Research has revealed that:

  • The active/deactive transition may play an important regulatory role in Complex I activity

  • Cysteine-39 of the ND3 subunit becomes accessible to chemical modification only in the deactive form of the enzyme

  • This conformational change likely represents a protective mechanism under certain physiological conditions

  • The transition between active and deactive states is associated with conformational changes of or around the ND3 subunit

Role in Superoxide Production

Complex I is recognized as a major source of reactive oxygen species in mitochondria and a significant contributor to cellular oxidative stress . The mechanism of superoxide production involves:

  • Transfer of electrons from fully reduced flavin to oxygen, resulting in superoxide formation

  • The rate being determined by a bimolecular reaction between oxygen and reduced flavin in an empty active site

  • The ratio and concentrations of NADH and NAD+ determining the rate of superoxide formation

This mechanism establishes a clear link between Complex I defects and pathological effects, with ND3 playing a critical structural role in the complex's integrity and function .

Recombinant Production of ND3

The development of recombinant technology has facilitated the production of ND3 proteins from various species, enabling detailed structural and functional studies.

Expression Systems and Methods

Current approaches for recombinant ND3 production primarily utilize bacterial expression systems:

Expression SystemFeaturesApplications
E. coliMost common host for recombinant ND3 expressionStructural studies, antibody production, functional assays
N-terminal His-taggingFacilitates purification via affinity chromatographyEnables high-purity isolation
LyophilizationProvides stable storage formMaintains protein integrity during storage

Research Applications of Recombinant ND3

Recombinant ND3 proteins serve as valuable tools for diverse research applications in mitochondrial biology and bioenergetics.

Disease-Related Research

The association of ND3 mutations with mitochondrial disorders makes recombinant proteins particularly valuable for:

  • Investigating the molecular basis of mitochondrial diseases like MELAS, Leigh syndrome, and LHON

  • Developing potential therapeutic approaches targeting Complex I dysfunction

  • Screening compounds that might stabilize or rescue mutant forms of ND3

  • Creating in vitro models of mitochondrial diseases

Role in Disease and Pathology

Mutations in the MT-ND3 gene and dysfunction of the ND3 protein are associated with several mitochondrial disorders:

DiseaseCharacteristicsAssociated ND3 Involvement
MELASMitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodesSpecific MT-ND3 variants
Leigh SyndromeSubacute necrotizing encephalomyelopathyMutations in the critical loop region of ND3
LHONLeber's hereditary optic neuropathyMT-ND3 variants contributing to optic nerve degeneration

The pathological mechanisms involve disruption of Complex I assembly, reduced enzymatic activity, increased production of reactive oxygen species, and impaired energy metabolism .

Future Research Directions

The ongoing investigation of recombinant ND3 presents several promising avenues for future research:

Therapeutic Development

Recombinant ND3 proteins could serve as platforms for:

  • Screening small molecules that modulate Complex I activity

  • Developing targeted approaches to mitigate oxidative stress

  • Engineering modified versions of ND3 with enhanced stability or function

Evolutionary Studies

The unusual features of ND3, such as the untranslated extra nucleotide in birds and turtles, present opportunities for exploring the evolutionary adaptations of mitochondrial function across diverse taxonomic groups.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nduo-3; nd3; MTCE.34; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
nduo-3
Target Protein Sequence
MLVLLMVLVFTLVLLFAFYLINFLLSIKDMGKNKISAFECGFVSVGKIQNSFSIHFFIMM LMFVIFDLEIVMFLGILVSDLSSYISFLMMFIFILGGFYMEWWYGKLVWVI
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be essential for the minimal assembly required for catalytic activity. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Database Links

KEGG: cel:ND3

STRING: 6239.MTCE.34

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 (nd3) and what is its role in cellular respiration?

NADH-ubiquinone oxidoreductase chain 3 (nd3) is a component of the mitochondrial respiratory chain, specifically within Complex I. Based on research with related oxidoreductases, nd3 functions as part of the electron transfer mechanism that enables the conversion of energy from NADH to ubiquinone. This process is fundamental to cellular respiration and energy production.

Unlike alternative NADH:ubiquinone oxidoreductases which are single subunit enzymes that transfer electrons without contributing to the proton gradient, nd3 functions as part of the larger multi-subunit Complex I structure which couples electron transfer with proton pumping across the respiratory membrane . This proton pumping activity is essential for establishing the electrochemical gradient that drives ATP synthesis.

The methodology for studying nd3's role involves comparative biochemical analysis between systems with functional and mutated versions of the protein, often using yeast models such as Yarrowia lipolytica which allows for genetic manipulation of respiratory components .

How is recombinant nd3 typically produced in a laboratory setting?

Production of recombinant nd3 in laboratory settings follows a multi-stage process that requires careful optimization of expression systems and purification techniques. The methodological workflow typically includes:

  • Gene acquisition and vector design: The nd3 gene sequence is either synthesized or amplified from genomic DNA and inserted into an appropriate expression vector with selected fusion tags (common options include His-tag, FLAG-tag, MBP, or GST) .

  • Expression system selection: Depending on research requirements, the construct can be expressed in prokaryotic systems (E. coli) for high yield, or eukaryotic systems (yeast, insect, or mammalian cells) for proper folding and post-translational modifications .

  • Transformation and culture: The expression construct is introduced into the selected host, followed by optimized growth conditions to maximize protein expression.

  • Induction and expression: Protein expression is typically induced using system-appropriate methods (IPTG for bacterial systems, specific media formulations for eukaryotic systems).

  • Cell lysis and initial clarification: Cells are disrupted using methods appropriate to the host organism, followed by centrifugation to remove cellular debris.

  • Purification protocol: A sequential purification strategy is implemented, typically beginning with affinity chromatography based on the chosen fusion tag, followed by additional purification steps as needed .

  • Quality assessment: The purified recombinant nd3 is analyzed for purity, integrity, and functional activity through techniques such as SDS-PAGE, Western blotting, and activity assays.

What are the common expression systems used for recombinant nd3 production?

The selection of an appropriate expression system for recombinant nd3 is critical to obtaining functional protein with the necessary post-translational modifications. Each system offers distinct advantages and limitations as summarized in the following table:

Expression SystemHost OptionsAdvantagesLimitationsBest Applications
E. coliBL21(DE3), JM115, Rosetta-GAMI High yield (up to g/L), rapid production, cost-effective, well-established protocolsLimited post-translational modifications, potential inclusion body formationStructural studies, antibody production, high-throughput screening
YeastSMD1168, GS115, X-33 Moderate yield, eukaryotic post-translational modifications, secretion capacityLonger production timeframes, hyperglycosylation potentialFunctional studies requiring some post-translational modifications
Insect CellSf9, Sf21, High Five High-quality eukaryotic post-translational modifications, good for membrane proteinsComplex setup, moderate yield, higher costStudies requiring authentic folding and modifications
Mammalian293T, CHO, COS-7 Native-like post-translational modifications, authentic foldingLowest yield, highest cost, longest production timeFunctional studies requiring human-like modifications

The methodological approach to selecting the appropriate system involves careful consideration of downstream applications. For structural studies where large quantities of protein are needed, E. coli is often preferred despite potential folding issues. For functional studies requiring proper post-translational modifications and membrane integration, mammalian or insect cell systems are typically more suitable despite their higher cost and complexity .

What purification techniques are most effective for recombinant nd3?

Purification of recombinant nd3 requires a systematic approach that typically combines multiple techniques to achieve high purity while maintaining protein integrity and activity. The methodological strategy often follows this sequence:

  • Affinity Chromatography: The primary purification step leverages fusion tags engineered into the recombinant nd3 construct. His-tagged nd3 can be purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co2+ resins, while GST-tagged proteins utilize glutathione-based matrices . This step typically achieves 70-90% purity.

  • Ion Exchange Chromatography: As a secondary step, this technique separates proteins based on charge differences. For nd3, which typically has a specific isoelectric point, either cation or anion exchange chromatography can be employed to remove contaminants with different charge properties.

  • Size Exclusion Chromatography: This polishing step separates proteins based on molecular size and shape, effectively removing aggregates and degradation products. For membrane proteins like nd3, detergent-compatible columns are essential.

  • Specialized Techniques for Membrane Proteins: Since nd3 is a membrane protein, additional considerations include:

    • Detergent selection for solubilization (common options include DDM, LMNG, or GDN)

    • Reconstitution into nanodiscs or liposomes for functional studies

    • Protein renaturation if expressed in inclusion bodies

  • Quality Control: Following purification, the protein should undergo rigorous quality assessment including:

    • Purity analysis via SDS-PAGE (target >95%)

    • Western blotting for identity confirmation

    • Mass spectrometry for molecular weight verification

    • Activity assays to confirm functional integrity

The optimal purification strategy must be empirically determined for each specific construct and expression system, with careful attention to maintaining the native conformation and enzymatic activity of nd3.

How do alternative NADH:ubiquinone oxidoreductases differ from complex I NADH:ubiquinone oxidoreductase?

Alternative NADH:ubiquinone oxidoreductases and complex I display significant structural, functional, and evolutionary differences that impact their roles in cellular metabolism. The methodological approach to distinguishing these systems involves comparative biochemical and genetic analyses:

CharacteristicAlternative NADH:ubiquinone oxidoreductasesComplex I NADH:ubiquinone oxidoreductase
Structural CompositionSingle subunit enzyme Multi-subunit complex (>40 subunits in mammals)
Proton PumpingDoes not contribute to proton gradient Couples electron transfer with proton pumping
Energy EfficiencyLower (no energy conservation)Higher (contributes to proton motive force)
Essentiality (in Y. lipolytica)Non-essential, encoded by NDH2 Essential, mutations in core subunits are lethal
Membrane LocalizationCan be present on external or internal face of mitochondrial inner membrane Integrated across the mitochondrial inner membrane
Inhibitor SensitivityResistant to complex I inhibitors like DQA Sensitive to specific inhibitors such as rotenone and DQA

Research in Yarrowia lipolytica has demonstrated that redirecting NDH2 (an alternative oxidoreductase) to the internal face of the mitochondrial inner membrane can rescue lethality in complex I mutations . This finding confirms that the primary essential function of complex I is NADH oxidation within the mitochondrial matrix, rather than its proton-pumping activity.

Methodologically, the distinction between these systems can be assessed through:

  • Inhibitor studies using complex I-specific inhibitors

  • Measurement of proton translocation using pH-sensitive dyes

  • Genetic complementation experiments as demonstrated in the Y. lipolytica model

  • Biochemical assays measuring electron transfer rates under varying conditions

What experimental designs are most appropriate for studying the function of recombinant nd3 in vitro?

Investigating the function of recombinant nd3 requires carefully structured experimental designs that account for its membrane-associated nature and role in electron transfer. The methodological framework should incorporate the following elements:

  • Hypothesis-Driven Approach: Establish clear, testable hypotheses about nd3 function that form the foundation of your experimental design . For example: "Recombinant nd3 maintains electron transfer activity when reconstituted into artificial membrane systems."

  • Variable Definition and Control:

    • Independent variables: May include substrate concentrations, pH, temperature, membrane composition

    • Dependent variables: Typically electron transfer rates, binding affinities, or structural parameters

    • Control variables: Must include appropriate negative controls (denatured protein) and positive controls (well-characterized related proteins)

  • Experimental Systems for Functional Analysis:

    • Proteoliposome Reconstitution: Incorporating purified nd3 into liposomes of defined composition to measure electron transfer in a native-like environment

    • Solid-Supported Membrane Electrophysiology: For direct measurement of electron transfer kinetics

    • Detergent-Solubilized Enzyme Assays: For initial screening of activity, though less physiologically relevant

  • Quantitative Measurements:

    • Spectrophotometric assays tracking NADH oxidation (340 nm) or ubiquinone reduction

    • Oxygen consumption measurements using Clark-type electrodes

    • Membrane potential measurements using potential-sensitive dyes

    • EPR spectroscopy to monitor redox states of electron carriers

  • Structure-Function Relationships:

    • Site-directed mutagenesis of key residues followed by functional assays

    • Chimeric protein construction to identify functional domains

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes during catalysis

  • Statistical Analysis:

    • Sample sizes should be determined through power analysis

    • Appropriate statistical tests based on data distribution (parametric or non-parametric)

    • Multiple comparison corrections when testing several conditions

The experimental design should progress from controlled in vitro systems to increasingly complex environments that better mimic physiological conditions. This methodical approach allows for initial characterization of basic enzymatic parameters followed by investigation of more complex functional aspects.

How can researchers address contradictions in experimental data related to nd3 function?

Contradictions in experimental data related to nd3 function are common challenges in respiratory chain research due to the complexity of membrane protein systems. A methodological framework for addressing these contradictions includes:

  • Systematic Classification of Contradiction Types:

    • Self-contradictions: Inconsistencies within a single study or dataset

    • Pair contradictions: Conflicting results between two independent studies

    • Conditional contradictions: Where results from one study create a contradiction between two others that were previously compatible

  • Data Quality and Methodological Assessment:

    • Evaluate experimental conditions across studies (detergents, membrane composition, pH, temperature)

    • Assess protein quality metrics (purity, stability, activity over time)

    • Examine methodological differences in activity measurements

    • Consider the relative positioning of conflicting information in published literature, as this can impact contradiction detection

  • Reconciliation Strategies:

    • Meta-analysis of published data with weighted consideration based on methodological rigor

    • Identification of key variables that might explain divergent results

    • Development of standardized assay conditions for nd3 functional studies

  • Targeted Experiments to Resolve Contradictions:

    • Design experiments specifically addressing the contradiction

    • Use multiple orthogonal techniques to measure the same parameter

    • Implement blinded experimental designs to reduce investigator bias

  • Consideration of Statement Importance:

    • Focus on resolving contradictions in high-importance statements first, as importance significantly affects contradiction detection accuracy

    • Prioritize contradictions related to core functional mechanisms over peripheral observations

  • Collaborative Approaches:

    • Multi-laboratory studies with standardized protocols

    • Round-robin testing of identical protein preparations

    • Development of community standards for nd3 functional assays

Models from large language model research suggest that pair contradictions are typically easier to detect than self-contradictions or conditional contradictions , indicating that researchers should be particularly vigilant for inconsistencies within their own datasets or those involving complex conditional relationships.

What are the challenges in redirecting nd3 to different cellular compartments and how can they be overcome?

Redirecting nd3 to different cellular compartments presents significant challenges due to its membrane protein nature and integration within respiratory complexes. The methodological approaches to overcome these challenges build upon successful strategies demonstrated with related proteins:

  • Challenges in Targeting Signal Design:

    • Competing signals: Native nd3 contains endogenous targeting signals that may interfere with redirection

    • Membrane integration: Ensuring proper membrane insertion in the new location

    • Protein folding: Maintaining correct conformation in different membrane environments

  • Methodological Solutions:

    • N-terminal fusion of targeting sequences: Research with NDH2 demonstrated successful redirection to the internal face of the mitochondrial inner membrane using the targeting sequence of NUAM (complex I's largest subunit)

    • Signal sequence optimization: Iterative testing of different signal sequence lengths and compositions

    • Transmembrane domain engineering: Modification of hydrophobic regions to match the target membrane characteristics

  • Functional Verification Strategies:

    • Subcellular fractionation followed by Western blotting to confirm localization

    • Fluorescent protein tagging for live-cell visualization of targeting efficiency

    • Activity assays in isolated organelles to confirm functional expression

    • Complementation assays in mutant cells lacking the endogenous protein, as demonstrated with NDH2 rescuing complex I mutations in Y. lipolytica

  • Expression System Considerations:

    • Selection of appropriate expression systems for studying redirected nd3

    • Titration of expression levels to prevent aggregation or incorrect targeting

    • Co-expression with potential assembly factors or chaperones

  • Regulatory Control Implementation:

    • Inducible expression systems to control the timing of redirected protein production

    • Degron tags for temporal control of protein presence in the target compartment

The research with NDH2 in Y. lipolytica provides an important proof-of-concept, demonstrating that alternative NADH:ubiquinone oxidoreductases require no additional components for catalytic activity when redirected to new locations . This finding suggests that nd3 may similarly retain functionality when properly redirected, though its integration into complex I may present additional challenges.

What are the latest methodologies for studying the interaction between nd3 and other components of the respiratory chain?

Investigating the interactions between nd3 and other respiratory chain components requires cutting-edge methodologies that can capture both static and dynamic aspects of these molecular relationships. The current state-of-the-art approaches include:

  • Integrated Structural Biology Techniques:

    • Cryo-electron microscopy (cryo-EM): Allows visualization of entire respiratory complexes at near-atomic resolution

    • Cross-linking mass spectrometry (XL-MS): Identifies interaction interfaces between nd3 and neighboring subunits

    • Single-particle analysis: Captures conformational heterogeneity in complex assemblies

    • Tomographic approaches: Visualizes respiratory complexes in their native membrane environment

  • Dynamic Interaction Analysis:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps protein-protein interaction surfaces and conformational changes

    • Förster resonance energy transfer (FRET): Measures distances between labeled components in real-time

    • Surface plasmon resonance (SPR): Quantifies binding kinetics between nd3 and potential interaction partners

    • Microscale thermophoresis (MST): Detects interactions based on changes in thermophoretic mobility

  • Functional Interaction Assessment:

    • Respiratory chain activity measurements in reconstituted systems

    • Supercomplex formation analysis using blue native PAGE

    • Electron flux measurements in the presence of specific inhibitors

    • Genetic complementation studies similar to those performed with NDH2 in Y. lipolytica

  • Computational Methods:

    • Molecular docking simulations to predict interaction interfaces

    • Coevolution analysis to identify co-varying residues as potential interaction sites

    • Molecular dynamics simulations of nd3 within the complex I environment

    • Network analysis of electron transfer pathways

  • Emerging Technologies:

    • Native mass spectrometry of intact respiratory complexes

    • High-speed atomic force microscopy for dynamic visualization

    • Single-molecule tracking in reconstituted membrane systems

    • In-cell structural biology using genetically encoded tags

  • Data Integration Frameworks:

    • Multi-scale modeling combining structural and functional data

    • Integrative visualization platforms for complex interaction networks

    • Machine learning approaches to predict interaction hotspots

When studying contradictions in interaction data, researchers should be aware that, according to research on large language models, pair contradictions are typically easier to detect than self-contradictions or conditional contradictions . This suggests that special attention should be paid to potential inconsistencies within single studies or those involving complex conditional relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.