Recombinant NADH-ubiquinone oxidoreductase chain 6 (nd6)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant ND6 refers to the genetically engineered version of the mitochondrially encoded NADH-ubiquinone oxidoreductase chain 6, a core subunit of respiratory Complex I (NADH dehydrogenase). This enzyme catalyzes electron transfer from NADH to ubiquinone, driving proton translocation and ATP synthesis . The recombinant form retains the functional properties of native ND6, enabling in vitro studies of its structural and mechanistic roles .

Production and Purification

Recombinant ND6 is typically expressed in E. coli with affinity tags for purification:

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His or Strep tags
Purity>90% (SDS-PAGE verified)
StorageLyophilized at -80°C in Tris/PBS buffer with 6% trehalose

Key Challenges: Low solubility due to hydrophobicity necessitates optimized solubilization protocols .

Role in Complex I Assembly

  • Mouse Studies: A frameshift mutation (C insertion at position 13,884) in MT-ND6 caused near-complete loss of Complex I activity, disrupting assembly of mitochondrial subunits .

  • Enzyme Activity: Mutant cells showed <1% NADH:ubiquinone oxidoreductase activity, highlighting ND6’s essential role .

Disease Associations

  • Leber’s Hereditary Optic Neuropathy (LHON): T14484C mutation in ND6 reduces ubiquinone binding efficiency, increasing reactive oxygen species (ROS) .

  • Leigh Syndrome: G14459A mutation alters alanine to valine (A72V), impairing electron transfer .

Diagnostic Tools

  • ELISA Kits: Human MT-ND6 ELISA kits detect concentrations as low as 5.86 pg/mL in serum/plasma .

MatrixAverage Recovery (%)Range (%)
Serum9488–98
EDTA Plasma8983–95

Functional Studies

  • Cryo-EM Structural Analysis: Recombinant ND6 aids in resolving Na+-NQR complexes (e.g., Vibrio cholerae), informing antibiotic design .

  • Mutagenesis: Used to map residues critical for ubiquinone binding and proton translocation .

Future Directions

Current research focuses on:

  • Engineering thermostable ND6 variants for crystallography .

  • Investigating ND6 mutations in aging-related mitochondrial decline .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please specify it, and we will prioritize developing it accordingly.
Synonyms
nd6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
nd6
Target Protein Sequence
MIKLFFVLAIFSSIISYMNIDPMKSSFFLIFSLLFSMPIISMSMHIWFSYFICLLFLSGI FVILVYFSSLSKINVVKSYMSLFLLLISIIYFSPVSMEYTNYLGLSGFYYSIYWFIFSFI LICLLFFMNFSSYFLNFSGALRKV
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) is believed to be a crucial component of the minimal assembly required for catalytic activity. Complex I plays a vital role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Database Links

KEGG: cbr:ND6

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 6 (ND6) and what is its role in cellular function?

NADH-ubiquinone oxidoreductase chain 6 (ND6) is a mitochondrially encoded subunit of respiratory Complex I, which plays a crucial role in the electron transport chain. It is strategically located at the junction between the P and Q modules of Complex I and is essential for creating the E-channel that facilitates electron flow within the complex . As part of Complex I, ND6 contributes to the transfer of electrons from NADH to ubiquinone, a process that generates a proton gradient across the inner mitochondrial membrane for ATP synthesis.

The structural importance of ND6 is highlighted by its involvement in maintaining Complex I stability. It contains alpha helices that interact directly with the Q module, ensuring proper assembly and function of the entire complex . Mutations or truncations in ND6 can significantly impact Complex I stability and activity, as demonstrated in recent studies of mitochondrial disease and cancer.

How does recombinant ND6 differ from native ND6 protein?

Recombinant ND6 is artificially produced in expression systems such as E. coli, whereas native ND6 is synthesized within mitochondria. The recombinant version typically includes tags (such as His-tags) to facilitate purification and detection, which are not present in the native protein . For example, commercially available recombinant rabbit ND6 is expressed with an N-terminal His-tag in E. coli systems .

The expression of recombinant ND6 often requires optimization of codons for the host expression system, as mitochondrial genetic code differs from the standard genetic code. Additionally, purification protocols must be carefully designed to maintain protein stability, as recombinant membrane proteins can be challenging to work with due to their hydrophobic nature.

While recombinant proteins aim to replicate the structure and function of native proteins, differences in post-translational modifications and folding environments can affect their properties. Researchers should validate recombinant ND6 against native controls when possible.

What are the recommended storage and handling procedures for recombinant ND6 protein?

For optimal maintenance of recombinant ND6 protein integrity, follow these evidence-based procedures:

  • Storage temperature: Store lyophilized ND6 protein at -20°C to -80°C upon receipt .

  • Aliquoting strategy: Divide the reconstituted protein into small working aliquots to avoid repeated freeze-thaw cycles, which can degrade protein quality .

  • Reconstitution protocol: Before opening vials, briefly centrifuge to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Add glycerol to a final concentration of 5-50% for long-term storage, with 50% being a commonly used concentration .

  • Working aliquots: For frequent use, store working aliquots at 4°C for up to one week rather than repeatedly freezing and thawing .

The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw cycles . When handling the protein, use appropriate laboratory safety measures and maintain sterile conditions to prevent contamination.

What expression systems are most effective for producing functional recombinant ND6 protein?

E. coli Expression System:

  • Advantages: Cost-effective, high yield, rapid growth

  • Optimization factors: Codon optimization, inclusion of solubility tags (His-tag), induction conditions

  • Limitations: Lacks post-translational modifications, inclusion body formation

Eukaryotic Expression Systems:

  • Yeast: Better for membrane proteins, more similar folding machinery

  • Insect cells: Enhanced post-translational modifications, superior for complex membrane proteins

  • Mammalian cells: Most authentic modifications, but lower yield and higher cost

For functional studies of ND6, researchers might consider using mitochondrial import systems that allow the recombinant protein to be incorporated into isolated mitochondria or submitochondrial particles.

Expression SystemProtein YieldPost-translational ModificationsComplexityCostTime Requirements
E. coliHighMinimalLowLowShort
YeastMedium-HighModerateMediumMediumMedium
Insect cellsMediumHighMedium-HighMedium-HighMedium-Long
Mammalian cellsLow-MediumVery HighHighHighLong

How can researchers verify the structural integrity of recombinant ND6 protein?

Verifying the structural integrity of recombinant ND6 involves multiple complementary methods:

  • SDS-PAGE and Western blotting: Use multiple antibodies targeting different epitopes of the protein. For instance, using both N-terminal and C-terminal antibodies can identify truncated forms . In a recent study, researchers used α-ND6 C-term antibody to recognize an epitope at the protein's C-terminal and α-ND6 N-term antibody to recognize an epitope at the N-terminal .

  • Blue Native PAGE (BN-PAGE): This technique allows assessment of ND6 integration into Complex I. Followed by immunoblotting with antibodies against Complex I subunits (such as NDUFS1), it can reveal whether ND6 properly assembles into the complex .

  • Molecular dynamics simulations: Computational approaches can provide insights into protein stability and conformational changes. Parameters to analyze include:

    • Residual Mean Square Fluctuation (RMSF) to detect protein movement

    • Solvent Accessible Surface Area (SASA) to assess conformational compactness

    • Native contact preservation to evaluate structural integrity

  • Mass spectrometry: This can confirm the molecular weight and sequence of the recombinant protein, identifying any truncations or modifications.

  • Circular dichroism (CD) spectroscopy: Useful for assessing secondary structure elements, such as alpha helices, which are critical for ND6 function.

What assays are available to assess the functional activity of recombinant ND6?

Several methods can be employed to evaluate the functional activity of recombinant ND6, particularly in the context of Complex I function:

  • In-gel activity assay: Performed after BN-PAGE separation, this assay involves incubating the gel with NADH and nitrotetrazolium blue chloride. Active Complex I catalyzes a reaction that changes the color of the gel, with the intensity correlating with activity levels . This technique allows direct visualization of Complex I activity and can be quantified through densitometry.

  • Oxygen consumption measurements: Using oxygen electrodes or plate-based respirometry (e.g., Seahorse XF Analyzer), researchers can measure oxygen consumption rates as an indicator of electron transport chain function.

  • NADH:ubiquinone oxidoreductase activity assay: This spectrophotometric method measures the rate of NADH oxidation in the presence of ubiquinone analogues (like decylubiquinone).

  • Proton pumping assays: These evaluate the ability of Complex I containing recombinant ND6 to establish a proton gradient, using pH-sensitive fluorescent dyes or measuring pH changes directly.

  • Superoxide production measurements: Since defective Complex I can increase reactive oxygen species production, measuring superoxide levels using probes like MitoSOX can provide functional insights.

For comprehensive assessment, researchers should combine multiple assays and compare results to positive and negative controls, such as samples with known wild-type or mutant ND6 activity.

How do mutations in the ND6 gene affect Complex I assembly and function?

Mutations in the ND6 gene can profoundly impact Complex I assembly and function, as evidenced by recent research on a truncated ΔND6 form :

  • Complex I stability: Biochemical analysis shows that ND6 mutations can reduce Complex I stability. In one study, a truncated ΔND6 form caused a significant reduction (56% ± 6.5%) in Complex I levels in tumor tissue compared to distal tissue . This destabilization was specific to Complex I, as Complex III and V showed no significant differences.

  • Enzymatic activity: Beyond structural effects, ND6 mutations directly impact Complex I activity. In-gel activity assays demonstrated a 55% ± 14% decrease in Complex I activity in mitochondria expressing truncated ΔND6 .

  • Subunit integration and assembly: Molecular dynamics simulations reveal that ND6 mutations can cause conformational rearrangements that disrupt interactions with other Complex I subunits. For example, the truncated ΔND6 loses approximately one-quarter of its original contacts with neighboring subunits .

  • Module assembly imbalance: ND6 mutations can differentially affect various Complex I assembly modules. Research shows that even when the holo-complex forms, it may be less stable due to imbalanced integration of subunits from different modules .

Effect of ND6 MutationExperimental EvidenceFunctional Consequence
Reduced Complex I stability56% ± 6.5% reduction in tumor tissueCompromised mitochondrial respiration
Decreased enzymatic activity55% ± 14% reduction in NADH oxidationInefficient electron transport
Altered protein conformationLoss of ~25% of native contactsDisrupted protein-protein interactions
Imbalanced subunit integrationDifferential expression of nuclear vs. mitochondrial encoded subunitsUnstable Complex I assembly

What are the methodological approaches for studying the interaction between ND6 and other Complex I subunits?

Investigating interactions between ND6 and other Complex I subunits requires sophisticated methodological approaches:

  • 2D Blue Native/SDS-PAGE: This powerful technique separates intact Complex I in the first dimension using BN-PAGE, followed by SDS-PAGE to separate individual subunits. It allows quantification of specific subunits' integration into Complex I. Studies have used this approach to demonstrate that even when adjusting for NDUFS1 levels (a nuclear-encoded subunit), the presence of mutant ΔND6 leads to lower integration of other subunits .

  • Cross-linking mass spectrometry: By introducing chemical cross-links between spatially proximal amino acid residues followed by mass spectrometry analysis, researchers can identify direct interactions between ND6 and neighboring subunits.

  • Cryo-electron microscopy: High-resolution cryo-EM can visualize the structure of Complex I and the position of ND6 within it, revealing interaction interfaces with other subunits.

  • Co-immunoprecipitation assays: Using antibodies against ND6 or other Complex I subunits, researchers can pull down protein complexes and analyze co-precipitated proteins to identify interaction partners.

  • Molecular dynamics simulations: Computational approaches can predict and analyze the dynamic interactions between ND6 and other subunits. Parameters such as Residual Mean Square Fluctuation (RMSF) and Solvent Accessible Surface Area (SASA) provide insights into structural changes that affect subunit interactions .

  • FRET (Förster Resonance Energy Transfer): By tagging ND6 and potential interaction partners with fluorescent proteins, researchers can measure energy transfer as an indicator of proximity between proteins.

How can researchers distinguish between the effects of ND6 mutations on Complex I assembly versus activity?

Distinguishing between assembly and activity effects requires careful experimental design and interpretative strategies:

  • Comparative analysis of protein levels versus activity:

    • Quantify Complex I levels using BN-PAGE with Coomassie staining or immunoblotting

    • Measure Complex I activity using in-gel activity assays

    • Calculate the activity-to-protein ratio to normalize activity to assembled complex levels

  • Stepwise assembly analysis:

    • Use antibodies against subunits representing different assembly modules (e.g., NDUFS1 for N module, NDUFS3 for Q module)

    • Compare the relative abundance of these subunits in assembled Complex I using 2D BN/SDS-PAGE

    • Imbalances in module representation suggest assembly defects rather than just activity issues

  • Time-course experiments:

    • Pulse-chase labeling of newly synthesized proteins

    • Track the incorporation of labeled subunits into Complex I over time

    • Delayed or reduced incorporation indicates assembly defects

  • Subcomplexes identification:

    • Look for accumulation of assembly intermediates using BN-PAGE

    • The pattern of subcomplexes can indicate where in the assembly process the defect occurs

  • Site-directed mutagenesis:

    • Create different mutations affecting either catalytic residues or structural regions

    • Compare their effects on assembly versus activity

    • This can help identify domains critical for each function

A comprehensive example from recent research demonstrates how these approaches can be integrated: when studying a truncated ΔND6 mutation, researchers first established reduced Complex I levels (56% reduction) through BN-PAGE, then measured activity within the remaining Complex I, finding a further 55% reduction in activity . This indicated both assembly and intrinsic activity defects from the same mutation.

What bioinformatic tools are recommended for analyzing ND6 sequence variations and predicting their functional impact?

Several specialized bioinformatic tools are essential for comprehensive analysis of ND6 sequence variations:

  • Variant calling and annotation tools:

    • GATK (Genome Analysis Toolkit): Specifically, HaplotypeCaller can be used for pooled samples to identify both germline and somatic variants

    • Mutect2: More sensitive for detecting somatic variants present in a small percentage of readings, particularly useful for mitochondrial DNA analysis

    • Variant Effect Predictor (VEP): Provides annotations including associated genes, codon changes, amino acid alterations, and potential clinical significance

  • Sequence alignment and conservation analysis:

    • MUSCLE or CLUSTAL: For multi-sequence alignment of ND6 across species to identify conserved regions

    • ConSurf: Maps conservation scores onto protein structures to identify functionally important regions

  • Structural prediction tools:

    • I-TASSER or AlphaFold: For predicting 3D structures of wild-type and mutant ND6

    • SWISS-MODEL: For homology modeling based on known Complex I structures

  • Molecular dynamics simulation platforms:

    • GROMACS or NAMD: For simulating protein dynamics to analyze parameters like RMSF and SASA

    • VMD (Visual Molecular Dynamics): For visualizing and analyzing simulation results

  • Pathogenicity prediction tools:

    • PolyPhen-2: Predicts possible impact of amino acid substitutions

    • SIFT: Predicts whether an amino acid substitution affects protein function

    • MutPred: Predicts the pathological significance of amino acid substitutions

For mitochondrial DNA-specific analysis, tools like MitoMap and HmtVar provide additional context by comparing variations against known mitochondrial DNA polymorphisms and mutations.

How should researchers interpret changes in Complex I stability versus activity when studying recombinant ND6 variants?

Interpreting the relationship between Complex I stability and activity requires nuanced analysis:

  • Distinguishing primary from secondary effects:

    • If activity reduction is proportional to stability reduction, the primary effect is likely on complex assembly or stability

    • If activity reduction exceeds stability reduction, the mutation likely affects both stability and catalytic function

    • If stability is reduced with preserved specific activity (activity per assembled complex), the mutation primarily affects assembly

  • Analyzing structure-function relationships:

    • Mutations in regions involved in electron transport (e.g., the E-channel) primarily affect activity

    • Mutations affecting interfaces with other subunits primarily impact stability

    • Mutations in the ND6 C-terminal region (as in the ΔND6 mutant) can affect both by disrupting interactions with the Q module

  • Quantitative approaches to interpretation:

    • Calculate the activity-to-complex ratio by normalizing activity measurements to complex abundance

    • Compare this ratio between wild-type and mutant samples to determine specific activity changes

    • In research examples, a 56% reduction in Complex I levels coupled with a 55% reduction in activity per complex indicates both assembly and catalytic defects

  • Contextualizing with cellular phenotypes:

    • Primarily stability effects may lead to compensatory upregulation of complex assembly

    • Primarily activity effects may trigger increased ROS production

    • Combined defects typically have more severe cellular consequences

  • Confirmation through complementary techniques:

    • Biochemical findings should be corroborated with structural predictions from molecular dynamics

    • For example, RMSF analysis showing increased protein movement coupled with SASA analysis indicating conformational compaction supports the interpretation of structural rearrangements affecting both stability and function

What statistical approaches are recommended for analyzing differences in ND6 expression and function between experimental conditions?

When analyzing ND6 expression and function across experimental conditions, researchers should employ robust statistical methods:

  • Quantitative protein expression analysis:

    • Western blot densitometry data should be analyzed using t-tests for comparing two conditions or ANOVA for multiple conditions

    • Include appropriate normalization controls (loading controls, housekeeping proteins)

    • Report means with standard deviation or standard error (e.g., "56% ± 6.5%" for Complex I reduction)

  • Complex activity measurements:

    • For in-gel activity assays, perform densitometry across multiple biological replicates

    • Apply paired statistical tests when comparing samples from the same source (e.g., distal vs. tumor tissue)

    • Report activity values normalized to complex abundance

  • Molecular dynamics simulation analysis:

    • For RMSF, SASA, and native contacts data, compare distributions rather than single values

    • Use non-parametric tests if normality assumptions are violated

    • Consider time-series analysis methods for trajectory data

  • Heteroplasmy quantification:

    • For mitochondrial DNA mutations, report the percentage of mutant mtDNA

    • Use specialized tools like bcftools to calculate the percentage of readings containing mutations

    • Consider binomial confidence intervals for heteroplasmy estimates

  • Multidimensional analysis:

    • Apply principal component analysis (PCA) or clustering methods when analyzing multiple parameters simultaneously

    • Use correlation analysis to identify relationships between different measurements (e.g., between complex stability and activity)

  • Replication and validation:

    • Ensure adequate biological replicates (minimum n=3)

    • Consider power analysis to determine appropriate sample sizes

    • Validate key findings using alternative methodological approaches

What are common challenges in expressing and purifying recombinant ND6, and how can they be addressed?

Researchers face several challenges when working with recombinant ND6 due to its hydrophobic nature and mitochondrial origin:

  • Poor expression yields:

    • Challenge: ND6 is a hydrophobic membrane protein that often expresses poorly in conventional systems

    • Solution: Optimize codon usage for the expression host; use specialized E. coli strains designed for membrane proteins; consider fusion partners that enhance solubility; adjust induction conditions (temperature, inducer concentration)

  • Protein aggregation:

    • Challenge: Hydrophobic membrane proteins tend to aggregate during expression and purification

    • Solution: Express at lower temperatures (16-18°C); add detergents during lysis and purification; include glycerol in buffers; use mild solubilization conditions

  • Inclusion body formation:

    • Challenge: Overexpressed ND6 often forms inclusion bodies in E. coli

    • Solution: Either optimize for soluble expression (as above) or develop refolding protocols from inclusion bodies using gradual detergent dialysis

  • Maintaining stability during purification:

    • Challenge: ND6 may denature during purification steps

    • Solution: Minimize freeze-thaw cycles; store with 6% trehalose and 5-50% glycerol; maintain consistent pH (typically pH 8.0); perform purification steps at 4°C

  • Verifying functional conformation:

    • Challenge: Ensuring the recombinant protein adopts a native-like conformation

    • Solution: Compare structural characteristics with native ND6 using circular dichroism; validate using functional assays that measure incorporation into Complex I

  • Maintaining activity after reconstitution:

    • Challenge: Lyophilized protein may lose activity upon reconstitution

    • Solution: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL; avoid vortexing; allow sufficient time for proper refolding before use

How can researchers address data inconsistencies when comparing ND6 function across different experimental models?

When faced with data inconsistencies across experimental models, researchers should employ systematic troubleshooting approaches:

  • Standardization of experimental conditions:

    • Develop consistent protocols for protein expression, purification, and functional assays

    • Use the same buffer compositions, pH, and temperature conditions across experiments

    • Standardize protein concentrations through accurate quantification methods

  • Reference controls for cross-platform normalization:

    • Include common reference samples across all experimental platforms

    • Use internal controls (e.g., housekeeping proteins) consistently

    • Consider spiking samples with known standards for absolute quantification

  • Model-specific considerations:

    • Account for differences in cellular background (e.g., nuclear genetic background affecting mitochondrial function)

    • Consider heteroplasmy levels when working with mitochondrial DNA mutations

    • Document differences in post-translational modifications across models

  • Technical variability assessment:

    • Perform replicate measurements to distinguish biological from technical variability

    • Calculate coefficients of variation for key measurements

    • Use statistical methods like Bland-Altman plots to compare measurement techniques

  • Validation across multiple methodologies:

    • Confirm key findings using orthogonal techniques

    • For example, validate BN-PAGE results with spectrophotometric enzyme assays

    • Use both antibody-based and activity-based detection methods

  • Integrated data analysis approaches:

    • Apply meta-analysis techniques when combining data from multiple experiments

    • Use Bayesian methods to incorporate prior knowledge when interpreting new results

    • Consider developing mathematical models that account for known differences between experimental systems

When reporting results from multiple models, clearly document the methodological differences and discuss how these might contribute to observed inconsistencies in the data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.