Recombinant NAD (P) transhydrogenase subunit alpha part 2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pntAB; nntA2; NAD(P transhydrogenase subunit alpha part 2; Nicotinamide nucleotide transhydrogenase subunit alpha 2; Proton-translocating transhydrogenase component 2; Pyridine nucleotide transhydrogenase subunit alpha 2; dII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Rhodospirillum rubrum
Target Names
pntAB
Target Protein Sequence
MEDKNILVEGFNQLSQQALELSQHAQALALQASHAVLPAAAATEGASEFWWLMTVFVLAC FIGFYVVWSVTPALHSPLMGVTNAISSVIVVGALIATGPEAFSASKVLGFFAILLASVNI FGGFIVTQRMLAMFKKKQK
Uniprot No.

Target Background

Function
NAD(P) transhydrogenase catalyzes the transhydrogenation between NADH and NADP+. This reaction is coupled to respiration and ATP hydrolysis and functions as a membrane-bound proton pump.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the general structure and functional organization of NAD(P) transhydrogenase?

Membrane-bound NAD(P) transhydrogenase consists of three distinct functional domains: domain I (binds NAD(H)), domain II (contains membrane-spanning helices), and domain III (binds NADP(H)). Domains I and III together facilitate hydride transfer between NAD(H) and NADP(H), while domain II facilitates proton translocation across the lipid bilayer . The enzyme is essentially a "dimer" of two dI-dII-dIII "monomers" with the nicotinamide and dihydronicotinamide groups positioned to allow direct hydride ion transfer between the C-4 positions of the rings .

In typical membrane-bound NTH, the primary structure includes two GXGXXG motifs within the β-sheet-α-helix-β-sheet domains (Rossman fold), one for binding NAD(P)H and another for binding FAD or FMN . These structural elements are critical for the enzyme's catalytic function.

How does the subcellular localization of NTH vary across different organisms?

Membrane-bound NTH shows remarkable variation in subcellular localization across taxa:

Organism TypePrimary LocalizationSecondary LocationsFunction
BacteriaCytoplasmic membrane-NADPH generation
MetazoansInner mitochondrial membrane-NADPH generation, ROS detoxification
Malaria parasites (Plasmodium)Crystalloid (in ookinetes)Apicoplast (in sporozoites)Essential for crystalloid biogenesis and sporozoite development

Unlike in other organisms, malaria parasites have co-opted NTH to non-mitochondrial organelles, where it provides critical NADPH reducing power . This unusual localization pattern highlights evolutionary adaptation of the enzyme's function.

What are the optimal conditions for measuring recombinant NTH activity in vitro?

When measuring recombinant NTH activity, pH plays a critical role in determining reaction directionality and rate. Based on studies with recombinant transhydrogenase expressed in S. cerevisiae, researchers should consider:

  • For reduction of 3-acetylpyridine-NAD+ by NADPH (reverse transhydrogenation): Use a buffer system with pH 6.8, which represents the activity optimum based on a bell-shaped pH-activity profile .

  • For reduction of 3-acetylpyridine-NAD+ by NADH in the presence of NADP+: Activity increases steeply as pH decreases from 7.0 to 6.0, with maximum activity at pH 6.0 .

These different pH profiles reflect distinct catalytic mechanisms. When designing activity assays, researchers should carefully control pH and include appropriate controls to distinguish between direct and cyclic reduction-oxidation mechanisms .

How can functional domains of NTH be identified and characterized experimentally?

To characterize functional domains of NTH experimentally:

  • Generate targeted deletions or truncations of specific domains (as demonstrated with NTHΔPP, where 60 amino acids were removed downstream of the ER signal peptide) .

  • Introduce point mutations in conserved residues (e.g., mutation of aspartic acid at position 500 to lysine abolishes both hydride transfer and proton-translocating activities) .

  • Express modified constructs and assess both structural integrity and enzymatic activity separately.

  • Perform subcellular localization studies using fluorescent tags (e.g., GFP fusion proteins).

This approach allows researchers to discriminate between structural and catalytic roles of specific domains. For instance, in Plasmodium, NTH with the D500K mutation retained structural integrity (formed crystalloids) but lacked enzymatic activity, demonstrating that NTH has separable structural and enzymatic functions in parasite development .

What expression systems are most effective for producing functional recombinant NTH?

Saccharomyces cerevisiae has proven effective for heterologous expression of bacterial NTH genes. When expressing E. coli pntA and pntB genes in yeast:

  • Use strong constitutive promoters like PGK and TDH3 to drive expression of each subunit .

  • For optimal expression, construct the expression plasmid with pntA under the control of the PGK promoter and pntB under the control of the TDH3 promoter .

  • Copy number significantly affects expression levels - high-copy plasmids (such as YEp24-based vectors) yield substantially higher transhydrogenase activity (1.51 U per mg protein) compared to low-copy plasmids (0.115 U per mg protein) .

Western blot analysis can confirm successful production of the recombinant enzyme, while activity assays using 3-acetylpyridine-NAD+ reduction can verify functional expression .

What strategies can overcome common challenges in membrane protein expression for NTH studies?

Membrane proteins like NTH present unique challenges for recombinant expression. Key strategies include:

  • Consider membrane targeting sequences appropriate for the host organism.

  • Test various fusion tags and their positions (N-terminal vs. C-terminal).

  • Optimize growth conditions (temperature, media composition) to balance expression rate with proper folding.

  • When working with eukaryotic expression systems, consider the capacity of cellular compartments where the protein will localize.

For instance, expressing bacterial transhydrogenase in yeast results in localization primarily to the endoplasmic reticulum, which influences the direction of the reaction due to differences in proton motive force compared to bacterial membranes .

How does heterologous NTH expression affect cellular redox balance and metabolite profiles?

Introducing recombinant NTH has profound effects on cellular redox balance and metabolism, as observed in S. cerevisiae expressing E. coli pnt genes:

  • NADPH/NADP+ ratio: Decreases from 5.0 in control strains to 2.0 in high-expression strains, confirming that transhydrogenase converts NADPH to NADH in vivo .

  • Total NADP pool: [NADPH] plus [NADP+] decreases by approximately 50%, suggesting strict regulation of NADP+ concentration .

  • NAD+ levels: Increase despite enhanced NADH formation, indicating rigid regulation of the NADH/NAD+ ratio .

  • Metabolite secretion: High-level NTH expression leads to increased secretion of 2-oxoglutarate and acetate, reflecting metabolic adjustments to altered redox balance .

These findings demonstrate that redox cofactor ratios are under tight homeostatic control, with metabolic pathways adjusting to compensate for perturbations caused by NTH activity.

What roles does NTH play in specialized organelles of parasites?

In Plasmodium parasites, NTH has evolved specialized functions distinct from its typical mitochondrial role:

  • Crystalloid function: In ookinetes (mosquito-stage parasites), NTH localizes to crystalloid organelles where it serves dual functions:

    • Structural role: Essential for crystalloid biogenesis independent of its enzymatic activity

    • Enzymatic role: Required for sporozoite development, indicating the crystalloid requires NADPH to function properly

  • Apicoplast function: In sporozoites, NTH also localizes to the apicoplast (a plastid of likely red algal origin), where it likely supplies NADPH required for anabolic activities in this organelle .

This unusual localization pattern addresses a longstanding question about potential NADPH sources for apicoplast metabolism and highlights the evolutionary adaptability of NTH to support parasite-specific organelle functions .

How can engineered NTH variants be used to manipulate cellular redox balance?

Engineered NTH variants offer powerful tools for manipulating cellular redox metabolism:

  • Direction control: Mutations affecting the proton-coupling mechanism can bias the reaction toward either NADPH or NADH production.

  • Subcellular targeting: Adding specific localization signals can direct NTH to different cellular compartments (mitochondria, cytosol, plastids), allowing compartment-specific redox manipulation.

  • Inducible expression: Placing NTH under control of inducible promoters enables temporal control of redox balance.

When engineering NTH, researchers should consider that even inactive enzyme variants may retain important structural functions, as demonstrated in Plasmodium crystalloids where catalytically inactive NTH still supports organelle formation .

What techniques can elucidate the relationship between NTH activity and proton motive force?

Understanding the coupling between NTH activity and proton translocation requires specialized techniques:

  • Membrane vesicle preparations with controlled orientation

  • Simultaneous measurement of transhydrogenase activity and membrane potential

  • pH gradient manipulation using ionophores

  • Direct measurement of proton pumping using pH-sensitive fluorescent probes

Research in S. cerevisiae expressing recombinant transhydrogenase suggests that the endoplasmic reticulum membrane environment may have insufficient proton motive force to drive the forward reaction, causing the enzyme to operate in reverse (converting NADPH and NAD+ into NADP+ and NADH) . This highlights the importance of membrane environment in determining reaction directionality.

What genetic approaches can determine the physiological importance of NTH in different organisms?

To investigate NTH physiological function:

  • Gene knockout/knockdown: Complete removal or reduction of NTH expression

  • Point mutations: Introduction of catalytically inactive variants (e.g., D500K mutation)

  • Domain deletion: Removal of specific functional domains to dissect separate roles

  • Reporter fusions: Attachment of fluorescent proteins to study localization and dynamics

  • Complementation studies: Expression of wild-type or mutant genes in knockout backgrounds

These approaches have revealed essential functions of NTH in diverse contexts, including the dual structural and enzymatic roles in malaria parasite development .

How do mutations in conserved NTH domains affect enzyme activity and cellular phenotypes?

Strategic mutations in conserved domains provide insight into structure-function relationships:

DomainMutation TypeEffect on ActivityCellular Phenotype
NAD(H)-binding (Domain I)Rossman fold GXGXXG motif alterationReduced NAD(H) binding and catalysisDepends on organism and localization
Membrane-spanning (Domain II)Charged residue substitutionDisrupted proton translocationUncoupled hydride transfer from proton pumping
NADP(H)-binding (Domain III)D500K mutationAbolished hydride transfer activityIn Plasmodium: intact crystalloid formation but defective sporozoite development

The D500K mutation in Plasmodium NTH demonstrates that enzymatic activity can be eliminated while preserving structural functions, allowing researchers to distinguish between these roles in complex biological processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.