Recombinant NAD (P) transhydrogenase subunit beta

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

NAD(P) transhydrogenase subunit beta is a membrane-bound oxidoreductase (EC 1.6.1.2) that catalyzes the reversible transfer of reducing equivalents between NAD(H) and NADP(H), coupled to proton translocation across membranes . The recombinant form is produced via heterologous expression systems (e.g., Escherichia coli, yeast, or mammalian cells) to enable biochemical and structural studies .

Key Catalytic Reaction:

NADPH+NAD+NADP++NADH\text{NADPH} + \text{NAD}^+ \leftrightarrow \text{NADP}^+ + \text{NADH}
This reaction is critical for maintaining NADPH pools essential for biosynthesis and antioxidant defense .

Production and Purification

Recombinant pntB is generated using diverse expression systems:

Table 2: Expression Systems and Yields

Host SystemPurityApplications
E. coli≥90%Structural studies
Yeast≥85%Functional assays
Mammalian cells≥85%Drug discovery
  • Storage: Liquid form in PBS with 50% glycerol (pH 7.4) at -20°C or -80°C .

Functional Insights

  • Proton Translocation:

    • Couples hydride transfer to proton pumping via a conserved transmembrane domain .

    • Mutations in βD392 disrupt NADP(H) binding, impairing catalytic activity .

  • Metabolic Regulation:

    • Recombinant pntB expression in Saccharomyces cerevisiae alters NADPH/NADH ratios, leading to 2-oxoglutarate secretion under ammonium stress .

    • Critical for mitochondrial NADPH production, impacting oxidative stress defense .

Research Applications

  • Enzyme Mechanism Studies:

    • Reconstitution into liposomes enables analysis of proton-coupled activity .

    • Cyclic reaction assays (e.g., NADH → NADPH) validate pH-dependent conformational changes .

  • Biotechnological Uses:

    • Engineered into microbial hosts to optimize NADPH-dependent pathways for bioproduction .

Clinical and Industrial Relevance

  • Disease Associations:

    • Mutations in the human homolog (NNT) cause glucocorticoid deficiency due to impaired NADPH synthesis .

    • Linked to heart failure via mitochondrial dysfunction .

  • Antioxidant Systems:

    • Supports glutathione recycling and redox homeostasis in pathogens like Plasmodium .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. Please include any desired format preferences in your order notes and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on your purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we prioritize fulfilling specific tag requests. Please specify your desired tag type and we will do our best to accommodate it.
Synonyms
pntB; nntB; NAD(P transhydrogenase subunit beta; Nicotinamide nucleotide transhydrogenase subunit beta; Proton-translocating transhydrogenase NADP(H-binding component; Pyridine nucleotide transhydrogenase subunit beta; dIII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-464
Protein Length
full length protein
Species
Rhodospirillum rubrum
Target Names
pntB
Target Protein Sequence
MTHSLTMAAYIVAGVLFILALRGLSNPESARNGNRMGMVGMAIAILTTLLSPSVQAYAWI VLAIAIGGAIGTVIAKKVLMTALPQLVAAFHSLVGMAAVLVATGALLNPEAYGIGSAGAI HAGSLVEMSLGLAVGAITFSGSVIAFGKLQGLIAGKPVTFPMQHPLNAVLGILLVVLLVV FAATESHTAYFALMILAFALGFLLIIPIGGADMPVVISMLNSYSGWAAAGIGFTLGNPLL IIAGALVGSSGAILSYIMCKGMNRSIFNVILGGFGSEGGVAAAGGAAGDRSVKAGSAEDA AFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLL AEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGT VLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Uniprot No.

Target Background

Function
The transhydrogenation reaction between NADH and NADP is coupled to respiration and ATP hydrolysis, serving as a proton pump across the membrane.
Protein Families
PNT beta subunit family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NAD(P) transhydrogenase and what functional role does the beta subunit play?

NAD(P) transhydrogenase (NTH) is an enzyme complex that utilizes the electrochemical proton gradient across membranes to drive the production of NADPH, playing a crucial role in maintaining cellular redox balance with implications in aging and various human diseases . The beta subunit (pntB) contains transmembrane helices that form part of domain II, which facilitates proton translocation across the lipid bilayer . The enzyme complex typically exists as a homodimer, with each protomer containing a proton-translocating transmembrane domain and two soluble nucleotide binding domains that mediate hydride transfer between NAD(H) and NADP(H) .

How is the structure of NAD(P) transhydrogenase organized?

NAD(P) transhydrogenase conforms to a general architecture consisting of three functional domains:

  • Domain I: Binds NAD(H) and is peripheral to the membrane

  • Domain II: Contains the membrane-spanning helices (typically 11 predicted transmembrane helices)

  • Domain III: Binds NADP(H) and is also peripheral to the membrane

Domains I and III together facilitate hydride transfer between NAD(H) and NADP(H), while domain II facilitates proton translocation across the lipid bilayer in which the NTH protein is embedded . The three-domain architecture is conserved across species, although the polypeptide composition differs substantially between organisms .

What expression systems are commonly used for recombinant NAD(P) transhydrogenase subunit beta?

Several expression systems have been successfully employed for producing recombinant NAD(P) transhydrogenase subunit beta:

  • E. coli expression systems

  • Yeast expression systems

  • Baculovirus expression systems

  • Mammalian cell expression systems

  • Cell-free expression systems

Each commercially available recombinant protein product typically achieves greater than or equal to 85% purity as determined by SDS-PAGE . The choice of expression system depends on research objectives, with E. coli being commonly used for basic structural studies and mammalian systems often preferred when post-translational modifications are important.

How does the proton translocation mechanism of NAD(P) transhydrogenase work at the molecular level?

The proton translocation in domain II of NAD(P) transhydrogenase involves a complex mechanism. Structural studies reveal that:

  • Domain II dimerization is mediated by TM2-TM2 interaction

  • Different pH conditions cause displacement of the second subunit (as observed in structures PDB: 5UNI and 4O93)

  • A proton channel exists within each subunit containing crystallographically resolved water molecules

  • A histidine residue (His42 α2 on TM3) acts as a channel gating mechanism

The proton translocation is functionally coupled to the hydride transfer reaction occurring between domains I and III. This coupling mechanism ensures that proton translocation across the membrane drives the thermodynamically unfavorable production of NADPH .

What is known about the hydride transfer mechanism between NAD(H) and NADP(H)?

Heterotrimeric structures of domains I and III reveal proximity between the NAD(H) and NADP(H) binding sites. Key aspects of this mechanism include:

  • Domain III inserts into the NAD(H)-binding cleft of one domain I subunit

  • NADP(H) in domain III is flipped in orientation to facilitate direct hydride transfer between the nicotinamide rings of NAD(H) and NADP(H)

  • Local conformational changes in the NAD(H) binding site occur during the reaction

  • Relative movement between two subdomains within domain I causes a "distal-to-proximal" motion of bound NAD(H)

The rate constants for nucleotide release are also critical: NADP+ release from domain III occurs at approximately 0.03 S-1, while NADPH release happens much more slowly at 5.6×10-4 S-1 . This difference in release rates has significant implications for the directionality of the transhydrogenation reaction.

How can researchers measure the kinetic parameters of recombinant NAD(P) transhydrogenase?

Several methodological approaches can be used to measure kinetic parameters:

  • Reverse transhydrogenation assay: A mixture of recombinant domain III protein and domain I protein can catalyze the reduction of acetylpyridine–adenine dinucleotide (AcPdAD+) by NADPH. This reaction rate is limited by the release of NADP+ from domain III .

  • Forward transhydrogenation assay: The mixture catalyzes reduction of thio-NADP+ by NADH at a rate limited by release of thio-NADPH from domain III .

  • Cyclic reaction measurement: The mixture also catalyzes rapid reduction of AcPdAD+ by NADH through a cyclic reaction mediated by tightly bound NADP(H) .

These measurements can be combined with titrations of domain I with domain III (and vice versa) to elucidate mechanistic details such as the number of domain III proteins that can interact with a single domain I protein during catalysis.

What purification strategies yield the highest purity of recombinant NAD(P) transhydrogenase subunit beta?

High-purity recombinant NAD(P) transhydrogenase subunit beta can be obtained through several methods:

  • Overexpression and refolding: For example, domain III of transhydrogenase from Rhodospirillum rubrum was expressed at high levels in E. coli, purified, and found to be associated with substoichiometric quantities of tightly bound NADP+ and NADPH .

  • Affinity chromatography: Utilizing the nucleotide-binding properties of the protein.

  • Size exclusion chromatography: For final polishing and determination of the oligomeric state.

Most commercial preparations achieve ≥85% purity as determined by SDS-PAGE . Researchers should consider that the protein may retain tightly bound nucleotides even after purification, which might affect subsequent functional studies.

How can researchers investigate the interaction between domains in NAD(P) transhydrogenase?

Several techniques can be employed to study domain interactions:

  • Fluorescence spectroscopy: Fluorescence spectra of the domain III protein reveal emissions due to tyrosine residues. Energy transfer between tyrosine residue(s) and bound NADPH indicates that these components are spatially close .

  • Rate measurements during domain titrations: Studying the rates of transhydrogenation reactions during titrations of domain I with domain III (and vice versa) can provide insights into interaction stoichiometry. For example, measurements have shown that during reduction of AcPdAD+ by NADPH, a single domain I protein can visit and transfer H- equivalents to about 60 domain III proteins during the time taken for a single domain III to release its NADP+ .

  • Crystallography: X-ray crystallography has revealed important structural features of domain interactions, such as the NAD(H) and NADP(H) binding sites being in proximity to facilitate direct hydride transfer .

What techniques are available for studying the membrane integration of NAD(P) transhydrogenase?

To study membrane integration of NAD(P) transhydrogenase, researchers can use:

  • Prediction tools for transmembrane helices: Bioinformatic analysis can predict the transmembrane regions. For example, the pntB gene product has been predicted to form 11 transmembrane helices .

  • Bipartite targeting sequence analysis: In organisms like Plasmodium, NAD(P) transhydrogenase has an amino-terminal ER signal peptide sequence that forms part of a bipartite apicoplast targeting sequence, which can be identified using prediction tools such as PATS (score 0.947 out of 1.000) and PlasmoAP (score 4 out of 5 tests positive) .

  • Structural studies under different pH conditions: Comparing structures solved under different pH conditions can reveal displacement of subunits and conformational changes related to proton translocation .

How to address issues with protein stability during NAD(P) transhydrogenase purification?

NAD(P) transhydrogenase stability can be challenging due to its membrane protein components. Several approaches can help:

  • Fe-S cluster considerations: In some cases, the enzyme (particularly the NadA component in bacteria) may be functionally unstable due to the presence of Fe-S clusters, which are subject to oxidative damage in vitro and potentially in vivo under excessive aeration conditions .

  • Reconstitution strategies: For instance, recombinant NadA has been successfully overexpressed, refolded from inclusion bodies, purified, and had its functional activity reconstituted in vitro when mixed with purified NadB protein .

  • Stabilizing additives: Including appropriate detergents for membrane components and antioxidants to prevent oxidative damage.

  • Buffer optimization: Testing various pH conditions and salt concentrations to maximize stability.

How can researchers determine if their recombinant NAD(P) transhydrogenase retains native function?

Several assays can confirm functional activity:

  • Hydride transfer assays: Measuring the rates of NAD(H)/NADP(H) interconversion using spectrophotometric methods.

  • Nucleotide binding analysis: Assessing the binding constants for NAD(H) and NADP(H) through fluorescence or other biophysical techniques. The purified protein may be associated with substoichiometric quantities of tightly bound NADP+ and NADPH .

  • Proton translocation measurements: In reconstituted proteoliposomes, measuring proton flux coupled to hydride transfer activity.

  • Comparison to wild-type enzyme: Using appropriate controls to compare the activity of the recombinant protein with that of the native enzyme.

What are emerging areas of NAD(P) transhydrogenase research?

Several exciting research frontiers are emerging:

  • Role in human diseases: Further investigation of NAD(P) transhydrogenase's implications in aging and various human diseases .

  • Non-mitochondrial functions: Exploration of vital non-mitochondrial functions, particularly in organisms like Plasmodium .

  • Regulatory networks: Investigating links between NAD metabolism and cellular regulatory networks, especially in the context of non-redox utilization of NAD .

  • Structural dynamics: Using advanced structural biology techniques to understand the complex domain coupling mechanism that is not fully understood despite extensive biochemical and structural characterizations .

  • Therapeutic targeting: Exploring NAD(P) transhydrogenase as a potential therapeutic target in diseases involving redox imbalance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.