Recombinant NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

ndhA is a plastid-encoded membrane protein integral to the chloroplast NDH complex, homologous to subunits of mitochondrial complex I . It localizes at the interface between Subcomplex A (SubA) and the membrane subcomplex (SubM), enabling electron transfer from stromal reductants to plastoquinone . The NDH complex participates in chlororespiration and optimizes photosynthesis under stress conditions .

Assembly Mechanism

  • Knockout studies in tobacco (ΔndhA) revealed that ndhA is essential for stabilizing SubA and SubE, but not other subcomplexes .

  • In the absence of ndhA, SubA assembly intermediates accumulate in the stroma, indicating its role in final membrane integration .

Electron Transport and Stress Adaptation

  • Facilitates cyclic electron flow (CEF) around PSI, crucial for ATP synthesis under high-light conditions .

  • Mediates post-illumination plastoquinone reduction, maintaining redox balance during dark-to-light transitions .

Mutant Phenotypes

MutantPhenotypeReference
Arabidopsis crr16Defective ndhA splicing; impaired NDH activity, reduced stress tolerance
Tobacco ΔndhALoss of SubA/SubE stability; disrupted NDH-PSI supercomplex assembly

Comparative Analysis with Other NDH Subunits

SubunitLocalizationFunctionDependency on ndhA
ndhBInverted repeatBinds FAD; electron transferIndependent
ndhKMembraneStructural stabilizationPartially dependent
ndhASubA-SubM interfaceMembrane integration of SubA/SubEEssential

Recombinant Expression Systems

  • Chloroplast transformation in tobacco remains the primary method for studying ndhA due to challenges in heterologous expression (e.g., codon bias, metabolic burden in E. coli) .

  • Key Findings:

    • ndhA splicing efficiency directly correlates with NDH activity .

    • SubA fails to integrate into the thylakoid membrane in ΔndhA mutants .

Open Questions

  • Regulatory mechanisms of ndhA splicing in response to environmental stress.

  • Structural details of ndhA’s interaction with PSI.

Implications for Bioengineering

  • Enhancing ndhA expression or splicing efficiency could improve plant stress resilience .

  • Synthetic biology approaches (e.g., CRISPR/Cas9) may enable targeted modifications for studying NDH assembly .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Our standard shipping includes blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Amborella trichopoda
Target Names
ndhA
Target Protein Sequence
MIIDTTEVQAINSFSRLESSKEVYGLIWLFIPIFTPVSGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQAIADGTKLLFKEDLLPSRGDIRLFSIGPSVVVISILLSHLVIPFGY RLVLADLSIGVSLWIAISSIAPIGLLMSGYASNNKYSFSGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQYKYGFWGWNLWRQPIGFLAFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYLASYLNLLVSSLFVTVLYLGGWNLSIPYIAIPELFRINRIGGV FGTTISIFFTLAKAYLFLFIPITTRWTLPRMRMDQLLNLGWKFLLPIALGNLLLTTSSQL FSL
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. The enzyme couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Database Links

KEGG: atr:2546599

Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the chloroplast NAD(P)H dehydrogenase complex and what role does ndhA play within it?

    The chloroplast NAD(P)H dehydrogenase (NDH) complex is involved in photosystem I (PSI) cyclic electron transport and chlororespiration. It consists of four subcomplexes: subcomplex A (SubA), membrane subcomplex (SubM), subcomplex B (SubB), and lumen subcomplex (SubL). The ndhA gene encodes a key component of the membrane subcomplex (SubM), which corresponds to the P module containing seven plastid-encoded subunits (NdhA to NdhG) . NdhA specifically functions as an anchor point, connecting the stromal subcomplex A to the membrane-embedded parts of the NDH complex, similar to the role of NuoH/Nqo8 in respiratory complex I .

  • How is the ndhA gene organized in the chloroplast genome?

    The ndhA gene is encoded in the plastid genome of most land plants. In many species, ndhA contains a group II intron that requires splicing for proper expression . The gene encodes a highly conserved peptide that shows homology with mitochondrial NADH-ubiquinone reductase subunit 1 (nad1) . The ndhA gene product, along with products of ten other plastid ndh genes (ndhB-ndhK), forms the core of the chloroplast NDH complex. These genes were originally discovered during plastid genome sequencing and show evolutionary relationships to cyanobacterial NDH-1 .

  • What techniques are commonly used to study ndhA gene expression and protein function?

    Several techniques are employed to study ndhA:

    • RNA extraction and RT-PCR: For analyzing transcript processing, including splicing and editing events

    • Electrophoretic mobility shift assays (EMSAs): To study protein binding to ndhA transcripts

    • Blue native PAGE: For separation and analysis of intact NDH complexes and NDH-PSI supercomplexes

    • Sucrose density gradient centrifugation: To isolate thylakoid membrane complexes

    • Chlorophyll fluorescence measurements: To monitor NDH activity by measuring transient increases in chlorophyll fluorescence after actinic light illumination

    • Mutant analysis: Using knockout or RNA-processing mutants (like crr16 in Arabidopsis) to study NDH function

Intermediate Research Questions

  • How does RNA editing affect ndhA transcript and what are the implications for the NDH complex function?

    RNA editing of ndhA transcripts involves C-to-U conversions at specific sites, which restore codons for evolutionarily conserved amino acids. In maize, for example, four C-to-U editing sites have been identified in ndhA mRNA . These editing events are critical because:

    • They restore amino acids that are conserved in ndhA-encoded peptides across chloroplast species

    • Some editing sites restore universally conserved amino acids also found in homologous mitochondrial nad1 sequences

    • At least one editing site is shared with nad1 mRNA of plant mitochondria

    Proper RNA editing is essential for producing functional NdhA protein. Defective editing could result in altered protein structure and impaired NDH complex assembly and function. Specific PPR (pentatricopeptide repeat) proteins, like CRR16 in Arabidopsis, are required for efficient splicing of the group II intron in ndhA pre-RNA .

  • What is known about the assembly pathway of the NDH complex and ndhA's role in this process?

    The assembly of the NDH complex involves multiple steps:

    1. Subcomplex A (SubA) is assembled in the stroma

    2. NdhA plays a critical role in incorporating SubA into the membrane-embedded part of the NDH complex

    3. NdhA serves as an anchor point to which SubA attaches on the stromal surface

    4. After assembly of the core NDH complex, it further associates with two copies of PSI supercomplex via minor LHCI proteins (Lhca5 and Lhca6) to form an NDH-PSI supercomplex exceeding 1 MD in size

    Defects in NdhA biogenesis significantly impact the stability and assembly of the entire NDH-PSI supercomplex. Studies of the Arabidopsis crr16 mutant, which is defective in ndhA transcript splicing, reveal that proper processing of ndhA is essential for NDH activity .

  • How can researchers differentiate between NAD(P)H dehydrogenase activity and other electron transport processes in chloroplasts?

    Researchers can differentiate NDH activity using several approaches:

    • Post-illumination chlorophyll fluorescence rise: After switching off actinic light, NDH-mediated electron donation to plastoquinone causes a transient increase in chlorophyll fluorescence, which is absent in NDH-deficient mutants

    • Comparison with PGR5/PGRL1-dependent cyclic electron transport: While both pathways mediate ferredoxin-dependent plastoquinone reduction, their contributions to proton motive force differ, with NDH having a smaller contribution than PGR5/PGRL1

    • Biosensor approaches: Using genetically encoded biosensors like NAPstars (specific for NADP redox state) in combination with NAD-specific sensors like Peredox to monitor redox changes

    • Mutant analysis: Comparing wild-type plants with specific knockout mutants of NDH subunits or assembly factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.