Recombinant NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction

NAD(P)H-quinone oxidoreductases (NDHs) are enzymes that catalyze the two-electron transfer from NAD(P)H to quinones, without any energy-transducing site . Chloroplastic NDHs are involved in the transfer of electrons from NAD(P)H:plastoquinone to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain . Specifically, recombinant NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a subunit of the chloroplast NDH complex .

Function and Location

NDH complexes are located in the thylakoid membranes of chloroplasts and are crucial for various photosynthetic processes . The NAD(P)H-quinone oxidoreductase subunit C1 (NDC1), also known as At5g08740, is a type II NAD(P)H quinone oxidoreductase that associates with plastoglobules . Plastoglobules are chloroplast lipid droplets that function in energy and prenylquinone metabolism . NDC1 influences the redox state of the plastoquinone pool by reducing the plastoquinone reservoir of plastoglobules .

NDC1 and Prenylquinone Metabolism

NDC1 is required for normal plastochromanol-8 (PC-8) accumulation and is essential for vitamin K1 production . Studies using HPLC and UHPLC-QTOFMS have shown that PC-8 concentration is significantly reduced in ndc1 mutants .

NDH Complex Structure

Ten plant chloroplast-specific NDH subunits' positions and interactions with other subunits in NDH have been elucidated .

Inhibitors of NAD(P)H:quinone oxidoreductase 1 (NQO1) Activity

Indolequinones, based on the 5- and 6-methoxy-1,2-dimethylindole-4,7-dione chromophores with a range of phenolic leaving groups at the (indol-3-yl)methyl position, can inhibit purified human NQO1 . The inhibition of recombinant human NQO1 (rhNQO1) is related to the $$pK_a$$ of the phenolic leaving group, indicating that these indolequinones act as mechanism-based inhibitors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Amborella trichopoda
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLMISSVIPILAFLISGVLAPISQGPEKVSSYESGIEPMGDAWIQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLIPIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Database Links

KEGG: atr:2546565

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) and what is its role in chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is one of eleven subunits (ndhA to ndhK) that comprise the chloroplast NAD(P)H dehydrogenase (NDH) complex, a homologue of mitochondrial complex I . This complex consists of more than 15 subunits in total and is found in the chloroplast genome of most land plants except pines and some parasitic plants .

The NDH complex plays a crucial role in cyclic electron flow around photosystem I and chlororespiration in chloroplasts . As part of this multiprotein complex, ndhC contributes to electron transport processes that help plants adapt to various environmental conditions. The Coomassie blue-stained polyacrylamide gel pattern of tobacco functional chloroplast NDH complex shows that various NDH subunits, including NdhK, are present in comparable amounts, suggesting a specific stoichiometric relationship necessary for proper function .

Studies of cyanobacterial NDH-1 complexes, which are closely related to chloroplast NDH complexes, suggest that the NdhC subunit directly interacts with NdhK via a long loop between two transmembrane domains . This structural arrangement is crucial for the assembly and function of the entire complex.

How is the ndhC gene organized in the chloroplast genome?

The ndhC gene is strategically positioned in the large single-copy (LSC) region of the chloroplast genome as part of the ndhC/K/J transcription unit . The chloroplast genome typically has a circular structure with four elementary regions—large single-copy region (LSC), small single-copy region (SSC), and two inverted repeats (IR1 and IR2)—organized as LSC-IR1-SSC-IR2 .

In most higher plants, the ndhC and ndhK genes partially overlap, creating a compact genetic arrangement that maximizes coding capacity within the size-limited chloroplast genome . In tobacco chloroplast DNA, the initiation codon of the ndhK cistron is located just 4 nucleotides upstream from the ndhC stop codon (UAG) . This overlapping configuration is highly conserved across many plant species, though some legumes have ndhC and ndhK separated by a spacer sequence .

The ndhC/K/J genes are cotranscribed, producing polycistronic transcripts long enough to include all three cistrons . This coordinated expression ensures proper stoichiometry of the encoded proteins for the assembly of the functional NDH complex.

What mechanisms ensure balanced production of NdhC and NdhK proteins from overlapping genes?

Despite the overlapping gene structure of ndhC and ndhK, the chloroplast translation machinery produces NdhC and NdhK in similar amounts . Several sophisticated mechanisms work together to achieve this balance:

Internal initiation pathway

Researchers have discovered an additional pathway for ndhK translation that explains the balanced production:

PathwayEntry PointMechanismDependency on ndhC Stop CodonContribution to NdhK Production
Pathway 1 (Translational Coupling)ndhC 5'UTRRibosomes translate ndhC and then reinitiate at ndhKYes~1/3 of total NdhK
Pathway 2 (Internal Initiation)Internal AUG (AUG 190) within ndhCFree ribosomes enter at internal AUG, translate C-terminal half of ndhC, reach ndhC stop codon, and resume ndhK translationYes~2/3 of total NdhK

Free ribosomes enter with formylmethionyl-tRNA fMet at an internal AUG start codon (AUG 190) located in-frame in the middle of the ndhC cistron . These ribosomes translate the 3' half of ndhC, creating a 57-amino-acid product termed "C-NdhC," and then some ribosomes continue to translate ndhK upon reaching the ndhC stop codon .

SD-like sequence for reinitiation

A Shine-Dalgarno-like sequence (GGGGG) is present 8 nucleotides upstream from the ndhK start codon in tobacco, which is optimally positioned for translational reinitiation . The effects of mutations in this sequence demonstrate its importance:

MutationLocationEffect on ndhK Translation
GaaaG (instead of GGGGG)SD-like sequence upstream of ndhK start codonAbolished ndhK translation
GGaGG (instead of GGGGG)SD-like sequence upstream of ndhK start codonOver twofold increase in ndhK translation

This SD-like sequence is conserved across species, appearing as GGGGG in tomato, potato, and soybean, and as GGAG in many other flowering plants .

What experimental systems have been developed to study ndhC gene expression in vitro?

Researchers have developed sophisticated in vitro translation systems to study the expression of ndhC and ndhK. The most significant advances have come from a highly active system developed using isolated tobacco chloroplasts . This system offers several methodological advantages:

Fluorescence-based quantification

The system enables precise estimation of relative translation rates through measurement of fluorescence intensity from either fused green fluorescent protein (GFP) or incorporated fluorescently labeled amino acids . This quantitative approach allows researchers to compare translation efficiencies across different experimental conditions.

Detection of translation products

Researchers can detect specific translation products using fluorescently labeled amino acids (e.g., lysyl-tRNA). The translation products are resolved by denaturing polyacrylamide gel electrophoresis (PAGE), and the fluorescence from incorporated amino acids is detected . This method enabled the identification of the C-NdhC peptide, providing crucial evidence for the internal initiation pathway.

Deletion analysis methodology

A systematic approach involving a series of 5'-deleted mRNAs helped determine which regions are necessary for ndhK translation independent of the ndhC 5'UTR . Researchers created constructs with progressive deletions (e.g., Δ7, Δ153, Δ202, Δ245) and found that deletion to around the middle of the ndhC cistron (from Δ7 to Δ153) still supported ndhK translation, while further deletions (Δ202 and Δ245) abolished it .

Site-directed mutagenesis

The system allows for precise mutagenesis of regulatory elements to study their effects on translation. For example, researchers have changed the ndhC stop codon (UAG) to UgG, which abolished translation of all test mRNAs, confirming that ndhK translation is termination-dependent . Similarly, mutations in the SD-like sequence upstream of the ndhK start codon revealed its role in translational reinitiation .

How do researchers investigate the translational coupling between ndhC and ndhK genes?

Translational coupling between ndhC and ndhK has been investigated using several complementary approaches:

Mutational analysis of stop codons

By mutating the ndhC stop codon (UAG) to UgG, researchers demonstrated that translation of the ndhK cistron depends absolutely on translational termination of the upstream ndhC cistron . This mutation arrests translation of the ndhK cistron by preventing the ribosome from terminating at the normal position, thus disrupting the coupling mechanism.

Interestingly, alternative stop codons UAA or UGA function similarly to the original UAG, maintaining translational coupling . This indicates that termination itself, rather than a specific stop codon sequence, is the critical factor.

Frameshift experiments

Researchers have shown that frameshift mutations in the ndhC coding strand also inhibit translation of the distal ndhK cistron . This finding provides further evidence that translation of ndhK depends on the proper translation of ndhC.

5'UTR removal experiments

Surprisingly, removal of the ndhC 5'UTR and its AUG still supported substantial translation of the ndhK cistron . This translation was abolished by removing the ndhC stop codon, confirming that even without the traditional entry point, ndhK translation remains termination-dependent .

In vitro translation of deletion constructs

By creating a series of 5'-deleted mRNAs and assaying their translation in vitro, researchers identified the minimal sequence requirements for translational coupling . Native gel patterns of translation products (mGFP bands) synthesized from these mRNAs showed that deletion to around the middle of the ndhC cistron still supported ndhK translation, but further deletions abolished it .

How does internal translation initiation within the ndhC cistron contribute to ndhK expression?

Internal translation initiation within the ndhC cistron represents a unique mechanism for delivering additional ribosomes to the ndhK cistron. This process involves multiple steps and has been characterized through detailed experimental work:

Identification of the internal start codon

Out of three internal in-frame AUG codons within the ndhC cistron, researchers determined that the second AUG codon (AUG 190) serves as the entry point for free ribosomes with formylmethionyl-tRNA fMet . This identification was achieved through systematic deletion analysis and translation assays.

Detection of the C-NdhC peptide

Researchers detected a 6.5 kDa peptide corresponding to the 57-amino-acid product encoded by the sequence from the internal AUG to the ndhC stop codon . This peptide, termed "C-NdhC," serves as direct evidence for internal initiation. The detection was accomplished using fluorescently labeled lysyl-tRNA in the in vitro translation system, followed by denaturing PAGE and fluorescence detection .

Enhancement of internal initiation

To enhance translation from the internal AUG start codon for better detection, researchers replaced the upstream sequence (+153 to +189) with the 5'UTR of phage T7 gene 10 mRNA, which is highly active . This modification produced a large amount of C-NdhC, making it clearly visible even when loading one-fifth of the standard amount .

Quantification of contribution

Based on fluorescent intensity and the number of lysine residues (1 in C-NdhC and 20 in NdhK), researchers estimated that the amount of C-NdhC was several-fold more than that of NdhK . Further analysis suggested that over 2/3 of NdhK is synthesized via the internal initiation pathway .

The researchers propose that the internal initiation site AUG is not designed for synthesizing a functional isoform but for delivering additional ribosomes to the ndhK cistron to produce NdhK in the amount required for the assembly of the NDH complex . This represents a unique translation strategy that ensures proper stoichiometry of component proteins, albeit with the metabolic cost of synthesizing the C-NdhC peptide.

What approaches can be used to edit the ndhC gene in chloroplast genomes?

While specific methods for editing ndhC have not been detailed in the provided research, chloroplast genome editing techniques could be adapted for ndhC modification. A promising two-step method has been developed for seamless editing of chloroplast genes:

Transient editing intermediate approach

This method involves first replacing the unedited wild-type sequence with a transient editing intermediate containing:

  • A partial duplication of the target gene

  • A selectable marker (such as aadA conferring antibiotic resistance)

  • The desired mutation in one copy of the duplicated sequence, creating imperfect directly repeated (iDR) sequences

Following transformation and selection, the intermediate form replaces the wild-type copies of the chloroplast genome. When selection pressure is released, recombination between the duplicated sequences removes the marker gene and leaves only the edited version .

Homologous recombination advantages

The chloroplast genome predominantly undergoes homologous recombination, which is a considerable advantage for genome editing . This eliminates the need for programmable nucleases to make double-strand breaks at editing sites, simplifying the editing process .

Monitoring editing events

The editing process can be monitored in vivo by engineering an overlapping reporter gene (such as gusA) downstream of the edited gene . For example, in a study with the rbcL gene, translational coupling between the overlapping rbcL and gusA genes resulted in relatively high GUS accumulation (~0.5% of leaf protein) , providing a visual indicator of successful editing.

Application to overlapping genes

For overlapping genes like ndhC/ndhK, special care would be needed to maintain the complex regulatory elements that ensure balanced translation. The editing strategy would need to preserve the ndhC stop codon, the ndhK start codon, and the SD-like sequence that are essential for translational coupling and internal initiation .

How do researchers distinguish between different pathways of ndhK translation?

Distinguishing between the different pathways of ndhK translation requires sophisticated experimental designs:

Deletion strategy

Researchers created a series of 5'-deleted mRNAs (Δ7, Δ153, Δ202, Δ245) and assayed their translation in vitro . They found that deletion to around the middle of the ndhC cistron (from Δ7 to Δ153) still supported ndhK translation, while Δ202 and Δ245 constructs lost translation activity . This approach helped identify the internal entry point for ribosomes in pathway 2.

Stop codon mutations

Changing the ndhC stop codon (UAG) to UgG abolished translation of all test mRNAs, indicating that all pathways of ndhK translation are termination-dependent . This finding was key to understanding that both pathway 1 (translational coupling from the ndhC 5'UTR) and pathway 2 (internal initiation) depend on proper termination at the ndhC stop codon.

5'UTR replacement experiments

To specifically enhance and study pathway 2, researchers replaced the upstream sequence (+153 to +189) of the internal AUG start codon with the highly active 5'UTR of phage T7 gene 10 mRNA . This modification dramatically increased the production of the C-NdhC peptide, providing clear evidence for internal initiation and allowing better characterization of this pathway.

Fluorescent labeling and quantification

By incorporating fluorescently labeled lysine residues and comparing the fluorescence intensity of C-NdhC (with 1 lysine) and NdhK (with 20 lysines), researchers could estimate the relative contributions of each pathway . This quantitative approach revealed that approximately two-thirds of NdhK is produced via pathway 2 (internal initiation).

What are the evolutionary implications of the overlapping ndhC and ndhK genes?

The overlapping arrangement of ndhC and ndhK genes has several evolutionary implications:

Genome compaction

The overlapping gene structure represents an efficient use of the limited genome space in chloroplasts . This compact arrangement allows more information to be encoded in a smaller genome, which may have been selected for during the evolution of chloroplast genomes.

Conservation across species

The overlapping arrangement of ndhC and ndhK genes is highly conserved across many plant species , suggesting that this genomic organization provides an evolutionary advantage. The conservation extends to regulatory elements, such as the SD-like sequence (GGGGG in tobacco, tomato, potato, and soybean; GGAG in many other flowering plants) .

Specialized translation mechanisms

The development of specialized translation mechanisms, such as translational coupling and internal initiation, indicates adaptive evolution to ensure proper protein stoichiometry despite the constraints imposed by overlapping genes . These mechanisms represent elegant solutions to the challenge of producing equal amounts of NdhC and NdhK from a single mRNA.

Variations in gene arrangement

While the overlapping arrangement is common, some plants show variations. For instance, in some legumes, ndhC and ndhK are separated by a spacer rather than overlapping . These variations provide opportunities to study the evolution of gene arrangements and translation mechanisms across different plant lineages.

What structural considerations are important when studying the ndhC protein?

Although detailed structural information about ndhC is limited in the provided research, several important considerations can be inferred:

Transmembrane domains

Based on studies of bacterial complex I, the NdhC protein is thought to contain transmembrane domains connected by a long loop . This structural feature is crucial for its interaction with NdhK and its function within the NDH complex.

Interaction interfaces

The long loop between two transmembrane domains of NdhC is thought to directly interact with NdhK . This interaction is critical for the assembly and stability of the NDH complex, highlighting the functional importance of specific structural elements.

C-terminal truncation implications

The internal initiation pathway produces C-NdhC, which lacks the N-terminal portion of the full-length NdhC . Researchers determined that C-NdhC lacks the loop that would interact with NdhK, suggesting it could not function as an isoform of NdhC . This structural consideration helped researchers conclude that C-NdhC is likely a by-product rather than a functional protein.

Stoichiometric considerations

The NDH complex has a specific stoichiometry, with NdhC and NdhK likely present in a 1:1 ratio based on the subunit composition of cyanobacterial NDH-1 complexes . This stoichiometric requirement influences how the proteins must be arranged within the complex and underscores the importance of balanced production.

How do chloroplast genome structural variations impact ndhC expression?

Although specific impacts on ndhC expression are not detailed in the provided research, general principles regarding chloroplast genome structural variations offer insights:

SSC switching phenomenon

A recent study revealed a phenomenon called "SSC switching," where forward and reverse orientations of the small single-copy region (SSC) exist in similar proportions within the same plant . This bi-directional configuration of the SSC could potentially affect the expression of genes located near the boundaries of this region.

Large inversions

Large inversions have been identified as the most common type of structural variation in chloroplast DNAs . Such inversions could alter gene contexts, potentially affecting gene expression through changes in promoter proximity, transcriptional unit organization, or RNA stability.

Recombination-driven variation

A recombination model has been proposed to explain the formation of large structural variations in chloroplast DNAs . Understanding these recombination mechanisms provides insight into how such variations might arise and persist, potentially affecting gene expression patterns across the chloroplast genome.

What are the methodological challenges in studying ndhC function in the NDH complex?

Studying ndhC function within the NDH complex presents several methodological challenges:

Low abundance issues

The NDH complex is present in very low amounts in chloroplasts , making it difficult to isolate sufficient quantities for biochemical and structural studies. This low abundance also complicates the detection of individual subunits like NdhC, which was not visible in Coomassie blue-stained SDS/PAGE of a tobacco chloroplast NDH complex while NdhK was detectable .

Functional stability challenges

The chloroplast NDH complex has low functional stability , which complicates in vitro studies of its activity and assembly. This instability may require specialized conditions for maintaining complex integrity during isolation and analysis.

C-NdhC detection limitations

Researchers were unable to detect the C-NdhC peptide in chloroplasts despite clear evidence for its production in vitro . This suggests that C-NdhC may be rapidly degraded in vivo, presenting challenges for studying the internal initiation pathway under physiological conditions.

Overlapping gene complexity

The overlapping nature of ndhC and ndhK genes, combined with multiple pathways for ndhK translation, creates complexity in experimental design and interpretation . Distinguishing the contributions of different pathways requires sophisticated approaches, as described in Section 8.

How do experimental conditions affect ndhC expression studies?

The influence of experimental conditions on ndhC expression studies can be significant:

In vitro translation system parameters

The efficiency of the in vitro translation system developed from tobacco chloroplasts depends on several parameters:

  • The quality and integrity of isolated chloroplasts

  • The concentration of essential components like magnesium, ATP, and amino acids

  • The mRNA constructs used (full-length vs. deletion constructs)

  • The detection system employed (GFP fusion vs. fluorescently labeled amino acids)

Variations in these parameters can significantly affect the results and their interpretation.

Mutation effects under different conditions

The effects of mutations in regulatory elements can vary depending on the experimental context. For example, mutation of the SD-like sequence from GGGGG to GGaGG led to over twofold increase in ndhK translation in vitro , but the impact in vivo might differ due to additional regulatory factors.

Detection threshold considerations

The detection of low-abundance products like C-NdhC requires sensitive methods and appropriate controls. In some cases, enhancing translation through the use of strong 5'UTRs (like the T7 gene 10 5'UTR) is necessary to bring the product above the detection threshold .

Stoichiometry measurement approaches

Different approaches to measuring protein stoichiometry (such as Coomassie blue staining, fluorescence-based quantification, or mass spectrometry) have different sensitivities and biases, which must be considered when interpreting results related to NdhC and NdhK abundance .

What are the current gaps in understanding ndhC function and expression?

Despite significant advances, several knowledge gaps remain:

In vivo validation of translation pathways

While the in vitro translation system has provided valuable insights into ndhC and ndhK translation mechanisms, in vivo validation of these pathways remains challenging . Specifically, the fate and role of the C-NdhC peptide in vivo require further investigation.

Regulatory mechanisms beyond basic translation

The search results focus primarily on the basic mechanisms of translational coupling and internal initiation, but less is known about how these processes are regulated in response to environmental conditions or developmental stages.

Species-specific variations

While the overlapping arrangement of ndhC and ndhK is conserved across many plants, species-specific variations in regulatory elements and translation mechanisms require further exploration. For example, the significance of the spacer between ndhC and ndhK in some legumes is not fully understood.

Functional significance of the NDH complex

Although the NDH complex is involved in cyclic electron flow and chlororespiration, its precise role in plant physiology and adaptation to various environmental conditions remains incompletely understood. This broader functional context is essential for fully appreciating the significance of ndhC and its expression regulation.

How can advanced molecular approaches enhance ndhC research?

Several advanced molecular approaches could significantly enhance ndhC research:

Chloroplast genome editing techniques

The seamless editing method described for chloroplast genes could be adapted specifically for ndhC research. This approach would allow precise modification of ndhC and ndhK sequences to test hypotheses about regulatory elements, protein interactions, and functional domains.

Next-generation sequencing applications

Long-read sequencing technologies could help resolve structural variations in the chloroplast genome that might affect ndhC expression . These approaches can provide insights into genomic contexts and large-scale rearrangements that traditional sequencing methods might miss.

Advanced protein visualization techniques

Techniques like cryo-electron microscopy could help determine the structure of the NDH complex and the precise positioning and interactions of the NdhC subunit. Such structural information would provide crucial insights into NdhC function.

Synthetic biology approaches

The overlapping gene arrangement of ndhC and ndhK, along with their translation mechanisms, provides an interesting model for synthetic biology applications. For example, the translational coupling mechanism could be adapted for coordinating the expression of foreign proteins in chloroplasts , opening new avenues for both basic research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.