Recombinant NAD (P)H-quinone oxidoreductase subunit 3, organellar chromatophore

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; PCC_0494; NAD(PH-quinone oxidoreductase subunit 3, organellar chromatophore; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Paulinella chromatophora
Target Names
ndhC
Target Protein Sequence
MFVLSGYDAFLGFLLIATAVPVLALLTNKILAPKSRNGERELTYESGMEPVGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVIALAYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers. This process likely occurs within the photosynthetic and potentially a chloroplast respiratory chain, with plastoquinone serving as the primary electron acceptor in this species. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy within a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, organellar chromatophore thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the relationship between NAD(P)H-quinone oxidoreductases and azoreductases?

NAD(P)H-quinone oxidoreductases and azoreductases share related reaction mechanisms, suggesting they form an enzyme superfamily. Mechanistically, both enzyme families catalyze similar redox reactions but with different substrate preferences. Research has demonstrated that enzymes previously classified solely as azoreductases also possess significant NAD(P)H-quinone oxidoreductase activity, often at rates higher than their azo reduction capabilities. This functional overlap indicates evolutionary relationships and potential shared catalytic mechanisms between these enzyme families .

To investigate this relationship experimentally, researchers typically measure quinone reduction rates by monitoring absorbance at 340 nm for NAD(P)H oxidation. Standard reaction mixtures contain 50 μM quinone, 500 μM NAD(P)H, and varying amounts of enzyme (0.1-10 μg) in buffer (20 mM Tris-HCl pH 8, 100 mM NaCl, 5% DMSO) . The dual functionality must be considered when characterizing new members of either enzyme family.

How do chromatophores convert light energy into chemical energy?

Chromatophores function as sophisticated biological energy conversion devices with three main components: an antenna system that harvests light, a battery-like component that directs captured energy, and a motor that produces ATP . The conversion process begins when light-harvesting complexes (the antenna) capture photons, generating excited electrons that are transferred through a series of redox reactions within the membrane-embedded protein complexes .

This energy transfer creates an electrochemical gradient across the chromatophore membrane, essentially establishing a charge distribution that drives ATP synthesis. Recent simulations revealed that the chromatophore's structure is not uniformly spherical as previously thought, but develops flattened areas and regions of high curvature that serve crucial biological functions . These structural features create patches of positive and negative charges that facilitate electron distribution throughout the system . Ultimately, these electrons are exchanged for protons that drive ATP synthase, the molecular motor responsible for ATP production .

What role does NAD(P)H:quinone oxidoreductase 1 (NQO1) play in cellular protection?

NAD(P)H:quinone oxidoreductase 1 (NQO1) functions as a critical detoxification enzyme with a dual protective role: it catalyzes the two-electron reduction of quinones, preventing the formation of reactive semiquinones, and serves as a direct superoxide scavenger. Experimental evidence demonstrates that fully reduced NQO1 undergoes auto-oxidation with a 1:1 stoichiometry of oxygen consumption to NADH oxidation, producing hydrogen peroxide .

The enzyme's superoxide scavenging function was confirmed through multiple experimental approaches, including:

  • Inhibition of dihydroethidium oxidation

  • Reduction of pyrogallol auto-oxidation

  • Elimination of potassium superoxide-generated signals in electron spin resonance studies

The auto-oxidation rate of fully reduced NQO1 increases significantly in the presence of superoxide (O₂⁻), while superoxide dismutase inhibits this auto-oxidation, further supporting NQO1's role as a superoxide scavenger . This activity provides an additional layer of cellular protection against oxidative stress beyond its canonical quinone reduction function.

How can researchers accurately measure NAD(P)H-quinone oxidoreductase activity in experimental systems?

Accurate measurement of NAD(P)H-quinone oxidoreductase activity requires careful consideration of multiple experimental parameters. The standard spectrophotometric method involves monitoring the decrease in absorbance at 340 nm, corresponding to NAD(P)H oxidation during quinone reduction. For precise measurements, researchers should establish the following conditions:

  • Reaction mixture components:

    • 50 μM quinone substrate

    • 500 μM NAD(P)H (ensuring >5:1 molar ratio to quinone)

    • 0.1-10 μg purified enzyme (depending on specific activity)

    • Buffer system: 20 mM Tris-HCl pH 8, 100 mM NaCl, 5% (v/v) DMSO

  • Experimental considerations:

    • Use UV-transparent 96-well plates for high-throughput analysis

    • Include enzyme-free controls to account for non-enzymatic reactions

    • Initiate reactions by adding enzyme and NAD(P)H solution to quinone

    • Maintain quinone concentrations within solubility limits

    • Ensure NAD(P)H concentrations remain within the linear detection range

The determination of kinetic parameters (KM and Vmax) may be challenging due to the poor aqueous solubility of many quinones and the need to maintain an excess of NAD(P)H while staying within instrument detection limits. Researchers should verify that measured activities fall within the initial linear portion of the rate curve to obtain reliable data .

What computational approaches are used to model chromatophore structure and function?

Modeling chromatophore structure and function requires sophisticated computational approaches that integrate multiple scales of biological organization. The most comprehensive model to date involved constructing a 136 million-atom simulation of the entire chromatophore organelle, requiring significant supercomputing resources over a four-year period . This approach incorporates several computational techniques:

The computational model revealed unexpected features, including the development of non-spherical morphology under physiological conditions and the formation of protein clusters that create patches of positive and negative charges facilitating electron distribution . This computational framework provides a template for studying other energy-converting organelles in diverse organisms.

How do polymorphisms in NQO1 affect enzyme function and their implications for research studies?

Polymorphisms in the NQO1 gene significantly impact enzyme function and must be considered when designing and interpreting research studies. The most well-characterized polymorphism occurs at position 609 of the NQO1 cDNA, resulting in a proline to serine substitution at position 187 of the enzyme . This polymorphism has profound effects on enzyme function:

  • Functional impact:

    • Homozygous mutation leads to complete loss of NQO1 activity in cell lines

    • Recombinant mutant protein retains only 2% of wild-type enzymatic activity

    • Mutant protein is either not translated or rapidly degraded in cells

  • Population prevalence:

    • Analysis of 90 human lung tissue samples revealed:

      • 7% of individuals homozygous for the mutation

      • 42% heterozygous for the mutation

      • 51% with wild-type genotype

  • Research implications:

    • Cell lines should be genotyped for NQO1 polymorphisms before use in studies

    • Expression systems may produce mutant protein detectable by immunoblot but with minimal activity

    • Studies involving NQO1-activated compounds must account for polymorphism frequency

    • Human tissue samples should be screened for polymorphism status when evaluating NQO1-dependent processes

The high frequency of this polymorphism in human populations has significant implications for cancer therapy, chemoprevention, and chemoprotection studies, particularly those involving compounds that require NQO1 for bioactivation or detoxification .

How does the structure of NAD(P)H-quinone oxidoreductase determine its substrate specificity?

The structure of NAD(P)H-quinone oxidoreductase plays a critical role in determining substrate specificity through several key structural features:

  • Active site architecture:

    • The size and shape of the active site influence which quinones can be accommodated

    • Variations in active site dimensions among different isoforms result in complementary substrate specificity profiles

    • Larger active sites (as in paAzoR3) can accommodate bulkier quinone groups

  • Binding pocket residues:

    • In P. capsici QOR, specific residues including R45, Q48, Y54, C147, and T148 help position the quinone substrate

    • The arrangement of these residues creates a hydrophobic environment around the positively charged nicotinamide cavity, which facilitates electron transfer

    • Stacking interactions between the quinone phenyl ring and the NADPH nicotinamide ring are critical for electron transfer

  • FMN redox potential:

    • The redox potential of the FMN group in different isoforms affects quinone reduction rates

    • Variations in FMN environment contribute to differences in catalytic efficiency among enzymes

Studies of multiple NAD(P)H-quinone oxidoreductases from the same organism reveal complementary substrate specificity profiles, suggesting evolutionary adaptation to handle different quinone substrates . This complementarity allows organisms to effectively process a wide range of quinone compounds, enhancing metabolic versatility and detoxification capabilities.

What structural features of bacterial chromatophores enable efficient light harvesting and energy conversion?

Bacterial chromatophores possess several specialized structural features that enable highly efficient light harvesting and energy conversion:

  • Membrane architecture:

    • Previously thought to be uniformly spherical, advanced simulations reveal that chromatophores develop non-uniform shapes with flat areas and regions of high curvature

    • This structural asymmetry creates functional domains that enhance energy transfer efficiency

    • The specific membrane curvature influences the organization and interaction of embedded protein complexes

  • Protein arrangement:

    • Under physiological conditions, certain membrane proteins cluster together rather than maintaining uniform distribution

    • This clustering creates patches of positive and negative charges that facilitate directional electron transfer

    • The spatial organization forms an electrical circuit-like arrangement that guides energy flow through the system

  • Integrated functional components:

    • Light-harvesting antenna complexes that capture photons

    • Battery-like electron transfer chains that store captured energy

    • ATP synthase motors that convert the electrochemical gradient into chemical energy (ATP)

    • The spatial relationship between these components minimizes energy loss during transfer processes

The chromatophore structure effectively functions as an electronic circuit diagram, with defined pathways for energy and charge movement . This highly organized architecture enables purple bacteria to efficiently extract energy from their environment under various light conditions, providing a model system for understanding fundamental principles of biological energy conversion that could inform the design of artificial photosynthetic systems.

How are computational simulations advancing our understanding of bacterial energy conversion systems?

Recent advances in computational simulations have revolutionized our understanding of bacterial energy conversion systems, particularly through the development of comprehensive atomic-level models:

  • Multi-scale modeling approaches:

    • The construction of a 136 million-atom model of the chromatophore represents a significant breakthrough in biological simulation

    • This achievement required specialized supercomputing resources, including Titan and Summit supercomputers at Oak Ridge National Laboratory and Blue Waters at the National Center for Supercomputing Applications

    • The approach integrates data from multiple experimental techniques, including electron microscopy and crystallography

  • Dynamic insights beyond static structures:

    • Simulations reveal unexpected behaviors not observable through static structural studies

    • When exposed to physiological conditions, the chromatophore model became less spherical and developed specialized regions of varying curvature

    • Specific proteins within the membrane clustered together, creating functional domains with distinct electrical properties

    • These dynamic behaviors appear essential for proper electron distribution and energy conversion

  • Future research directions:

    • The computational framework established for chromatophores provides a template for studying more complex energy-generating organelles in other organisms

    • Similar approaches could be applied to chloroplasts, mitochondria, and other bioenergetic systems

    • These simulations contribute to understanding nature's solutions to efficient energy extraction without generating toxic byproducts

The advanced simulations demonstrate that at the atomic scale, physical principles directly drive biological function, providing a mechanistic understanding of how these remarkable biological machines operate .

What is the proposed catalytic mechanism of NAD(P)H:Quinone Oxidoreductases based on recent structural studies?

Recent structural studies, particularly the crystal structure of NADPH-dependent Quinone Oxidoreductase from Phytophthora capsici (PcQOR) complexed with NADPH at 2.4 Å resolution, have provided detailed insights into the catalytic mechanism:

  • Substrate binding and positioning:

    • When quinone enters the active pocket, it is precisely positioned by interactions with specific residues including R45, Q48, Y54, C147, and T148

    • The NADPH nicotinamide ring participates in positioning the substrate through stacking interactions

    • This positioning aligns the quinone for optimal electron transfer

  • Electron transfer mechanism:

    • The phenyl ring of the quinone substrate stacks against the nicotinamide ring of NADPH

    • The hydrophobic environment surrounding the positively charged nicotinamide cavity facilitates electron transfer

    • Electrons move from NADPH to the substrate within the ternary enzyme-NADPH-substrate complex

  • Product release:

    • Upon reduction of the quinone carbonyl group, hydrogen bonds between the quinone and side chains of R45, Q48, and Y54 are broken

    • The completion of the reduction reaction triggers conformational changes that open the substrate-binding pocket

    • These changes facilitate release of the reduced product

This proposed mechanism highlights the importance of specific protein-substrate interactions in facilitating the two-electron reduction of quinones, preventing the formation of reactive semiquinone intermediates that could generate harmful reactive oxygen species. The detailed understanding of this mechanism provides valuable insights for enzyme engineering approaches aimed at enhancing catalytic efficiency or modifying substrate specificity.

How does the role of NAD(P)H-quinone oxidoreductases as superoxide scavengers change our understanding of their biological function?

The discovery that NAD(P)H:quinone oxidoreductase 1 (NQO1) functions as a superoxide scavenger significantly expands our understanding of its biological role beyond its canonical function in quinone metabolism:

  • Dual protective mechanisms:

    • Traditional view: NQO1 detoxifies quinones through obligate two-electron reduction, bypassing reactive semiquinone formation

    • Expanded role: NQO1 directly scavenges superoxide (O₂⁻), providing additional protection against oxidative stress

    • This dual functionality positions NQO1 as a multifaceted cellular defense enzyme

  • Experimental evidence:

    • Auto-oxidation of fully reduced NQO1 is accelerated by superoxide and inhibited by superoxide dismutase

    • NQO1 with NADPH inhibits dihydroethidium oxidation and pyrogallol auto-oxidation, established markers of superoxide scavenging

    • Electron spin resonance studies confirm elimination of superoxide-generated signals by NQO1

  • Research and therapeutic implications:

    • Compounds that induce NQO1 expression may provide broader antioxidant protection than previously recognized

    • The superoxide scavenging function may contribute to the chemopreventive effects of NQO1 induction

    • This expanded role suggests potential therapeutic applications in conditions characterized by oxidative stress

    • Research methodologies must account for both quinone reductase and superoxide scavenging activities when studying NQO1 function

This expanded understanding of NQO1 function highlights the multifunctional nature of many metabolic enzymes and emphasizes the importance of considering secondary activities when characterizing enzyme function and developing therapeutic strategies targeting these pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.