| Attribute | Value |
|---|---|
| Catalog Number | RFL25895PF |
| Storage Buffer | Tris-based buffer + 50% glycerol |
| Storage Temperature | -20°C (long-term), 4°C (short-term) |
| AA Sequence | MTImLEAYLTLAAVLFCIGVWGLINSRNAVRVLMSIELmLNAVNINLMAFSNYLDGELIR GQVFAIFVITVAAAEAAVGLAILLSLYRNRQTVDMERFNLLRW |
Note: The sequence includes a lowercase "m" (position 11), likely a typographical error; corrected to uppercase "M" for clarity.
While subunit 4L itself lacks catalytic activity, it is integral to the NADH dehydrogenase complex. Related oxidoreductases like NQO1 (human NAD(P)H:quinone oxidoreductase) demonstrate:
Subunit 4L’s role may involve stabilizing the complex or facilitating quinone binding.
Recombinant subunit 4L is employed in immunoassays to study protein-protein interactions or organelle-specific pathways ( ).
Limited structural data: No direct crystallographic studies on subunit 4L exist; homology modeling is required.
Functional ambiguity: The exact role of subunit 4L in electron transport remains under investigation.
NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a critical component of the electron transport chain found primarily in chloroplasts. This protein facilitates electron transfer from NAD(P)H to quinones, playing an essential role in energy metabolism and photosynthesis . The protein is encoded by the ndhE gene (also sometimes referred to as ndh4L) and is part of a larger NAD(P)H dehydrogenase complex that contributes to cellular redox homeostasis .
In chloroplasts, this protein participates in cyclic electron flow, which helps maintain the proper balance of ATP and NADPH required for photosynthesis. The oxidoreductase activity also contributes to cellular detoxification mechanisms by catalyzing the reduction of quinones, preventing the formation of harmful semiquinone radicals that can cause oxidative damage .
Research methodological approach: When investigating this protein, researchers typically employ recombinant expression systems (E. coli, yeast, baculovirus, or mammalian cells) to produce sufficient quantities for structural and functional studies . Biophysical techniques including X-ray crystallography and electron microscopy are then used to characterize its structure, while spectrophotometric assays monitor its enzymatic activity.
Organellar chromatophores represent one of nature's most primitive and efficient light-harvesting structures, particularly well-studied in purple bacteria. These specialized membrane-bound structures operate as complete photosynthetic units that convert light energy into chemical energy with remarkable efficiency .
Recent research using supercomputer simulations has revealed that chromatophores function as an integrated three-component system:
An antenna system that captures photons
A battery component that stores captured energy
The chromatophore's structure is not perfectly spherical as once thought but contains flat areas and regions of high curvature that create patches of positive and negative charges. This arrangement facilitates electron distribution across the system, functioning essentially as a biological circuit diagram . When exposed to light, electrons are mobilized and ultimately exchanged for protons that drive ATP synthase, producing ATP for cellular processes.
Research methodological approach: Studying these structures requires multidisciplinary techniques including massive computer simulations (requiring supercomputers like Titan and Summit), electron microscopy, and spectroscopic analysis to understand their structure-function relationships .
NAD(P)H-quinone oxidoreductases play a crucial role in cellular detoxification by catalyzing the two-electron reduction of quinones to hydroquinones . This biochemical process is particularly important for:
Preventing formation of semiquinone radicals that can generate reactive oxygen species
Detoxifying synthetic compounds and environmental toxins
Protecting cells from quinone-induced oxidative stress
In pathogenic organisms such as Phytophthora capsici, NAD(P)H-quinone oxidoreductases likely aid in detoxifying harmful chemicals encountered during host invasion, contributing to virulence and survival . Enzymatic assays with P. capsici QOR indicate a preference for larger substrates like 9,10-phenanthrenequinone, suggesting specialization for specific detoxification pathways .
| Detoxification Function | Mechanism | Biological Significance |
|---|---|---|
| Quinone reduction | Two-electron transfer from NAD(P)H to quinone | Prevents formation of toxic semiquinone intermediates |
| Xenobiotic metabolism | Reduction of exogenous quinones | Protection against environmental toxins |
| Oxidative stress prevention | Maintaining cellular redox balance | Prevents oxidative damage to cellular components |
| Pathogen virulence | Detoxification of host defense compounds | Enhances survival during infection processes |
NAD(P)H-quinone oxidoreductases exhibit a bi-modular architecture optimized for electron transfer. Based on crystallographic studies of related enzymes like PcQOR, each subunit contains:
A NADPH-binding groove that precisely positions the nicotinamide ring
A substrate-binding pocket that accommodates various quinone substrates
The enzyme typically functions as a tetramer in solution, with each asymmetric unit containing two molecules stabilized by intermolecular interactions . This quaternary structure is essential for proper enzyme function and stability.
Key structural features that facilitate electron transfer include:
Conserved binding sites for the nicotinamide ring of NAD(P)H
Hydrophobic residues that create the proper microenvironment for electron transfer
Specific amino acid residues (e.g., R45, Q48, Y54, C147, and T148 in PcQOR) that position the quinone substrate for optimal electron transfer
A quinone-binding channel that allows substrate entry and product release
Chromatophores represent a masterpiece of natural engineering, with structural features perfectly adapted for efficient light harvesting and energy conversion. Research using 136 million-atom models has revealed several key structural characteristics:
Non-spherical morphology with flat areas and regions of high curvature that optimize light capture and energy transfer
Strategic arrangement of protein complexes that creates patches of positive and negative charges to facilitate electron distribution
Precise spatial organization that minimizes energy loss during transfers between components
When exposed to environmental stresses like changing salt concentrations, the chromatophore structure dynamically responds, demonstrating that its seemingly imperfect shape has significant biological advantages. The protein arrangement essentially creates a circuit diagram that directs energy and charge flow through the system with remarkable efficiency .
The chromatophore's structure confirms that physics drives biology at the atomic scale, providing insights into nature's solution to efficient energy extraction without generating harmful byproducts . This natural design continues to inspire biomimetic approaches to artificial photosynthetic systems.
Based on structural and functional studies of related enzymes like PcQOR, the following catalytic mechanism has been proposed for NAD(P)H-quinone oxidoreductases:
Substrate Entry and Positioning: When a quinone substrate enters the active pocket, it is repositioned by interactions with specific amino acid residues (R45, Q48, Y54, C147, T148) and the NADPH nicotinamide ring .
Electron Transfer Initiation: Electron transfer occurs when the phenyl ring of the quinone substrate stacks against the nicotinamide ring of NADPH. The hydrophobic environment surrounding the positively charged nicotinamide cavity stimulates electron transfer from NADPH to the substrate in the ternary enzyme-NADPH-substrate complex .
Quinone Reduction and Product Release: Following reduction of the quinone carbonyl group, hydrogen bonds between the quinone and amino acid side chains are broken. The substrate-binding pocket then opens to release the reduced product .
This mechanism highlights the importance of specific protein-substrate interactions and the precisely controlled microenvironment in facilitating efficient electron transfer reactions.
| Step | Key Interactions | Structural Elements Involved |
|---|---|---|
| Substrate binding | Hydrogen bonding, π-stacking | R45, Q48, Y54, C147, T148 side chains |
| Electron transfer | Hydrophobic interactions, π-stacking | Nicotinamide ring, quinone phenyl ring |
| Product release | Conformational change | Substrate-binding pocket opening |
Successful expression and purification of recombinant NAD(P)H-quinone oxidoreductase subunit 4L requires careful optimization of expression systems and purification protocols. Based on available research data, the following conditions are recommended:
Expression Systems and Conditions:
| Expression System | Advantages | Considerations |
|---|---|---|
| E. coli | High yield, cost-effective, rapid growth | Limited post-translational modifications |
| Yeast | Eukaryotic modifications, high-density cultures | Longer expression time, more complex media |
| Baculovirus | Superior folding, complex modifications | Higher cost, technical complexity |
| Mammalian cells | Native-like modifications, proper folding | Lowest yield, highest cost |
Purification and Storage Conditions:
Storage temperature: -20°C for routine storage; -80°C for long-term storage
Working aliquots can be maintained at 4°C for up to one week
Avoid repeated freeze-thaw cycles as they compromise protein integrity
Research methodological approach: When developing expression protocols, researchers should conduct small-scale expression trials with various host systems before scaling up. Purification typically involves affinity chromatography (if tagged constructs are used), followed by size-exclusion chromatography to ensure high purity and remove aggregates.
Studying the complex structure and function of chromatophores requires an integrated multidisciplinary approach combining various advanced techniques:
Supercomputer Simulations: Recent breakthrough research utilized supercomputers (Titan and Summit at Oak Ridge National Laboratory and Blue Waters at NCSA) to construct a 136 million-atom model of a bacterial chromatophore, revealing dynamic structural features not observable through static methods .
Electron Microscopy: High-resolution electron microscopy, particularly cryo-EM, provides structural insights into the organization of protein complexes within the chromatophore membrane .
Spectroscopic Methods: Various spectroscopic techniques (absorption, fluorescence, circular dichroism) characterize light-harvesting properties and energy transfer processes in intact chromatophores.
Molecular Dynamics Simulations: These simulations reveal how chromatophores respond to different environmental conditions, such as varying salt concentrations that trigger conformational changes with functional significance .
Integrated Data Analysis: Combining data from multiple techniques is essential for developing a comprehensive understanding of chromatophore structure-function relationships.
Research methodological approach: The most successful studies, like those conducted by the late Klaus Schulten and colleagues, combine experimental data from various sources with sophisticated computational modeling over extended periods (four years of supercomputer time in their case) .
Site-directed mutagenesis represents a powerful approach for investigating the functional importance of specific amino acid residues in quinone oxidoreductases. This technique has been successfully applied to identify critical residues involved in substrate binding and catalysis.
Methodological Workflow:
Target Identification: Use computational simulation and structural analysis to identify potential quinone-binding residues for mutagenesis .
Mutant Design: Generate mutations that alter specific properties (charge, size, hydrophobicity) of binding site residues to test their functional importance .
Expression and Purification: Express wild-type and mutant proteins under identical conditions to ensure valid comparisons .
Activity Assays: Compare enzymatic activities of wild-type and mutant enzymes with various substrates to determine how specific mutations affect substrate binding and catalysis .
Structural Confirmation: When possible, obtain crystal structures of mutant proteins to directly observe changes in the binding pocket .
This integrated approach has successfully identified quinone-binding channels and critical residues (R45, Q48, Y54, C147, T148) involved in substrate binding in enzymes like PcQOR . The combination of computational prediction with experimental validation provides particularly robust insights into structure-function relationships.
NAD(P)H-quinone oxidoreductases play a crucial role in maintaining cellular redox balance through their electron transfer activities. Variations in their activity can have wide-ranging effects on cellular metabolism and stress responses:
Electron Transport Chain Efficiency: Changes in oxidoreductase activity can alter electron flow through respiratory or photosynthetic electron transport chains, affecting ATP production and energy metabolism .
Reactive Oxygen Species (ROS) Management: By preventing the formation of semiquinone radicals, these enzymes help minimize ROS generation. Reduced activity may increase oxidative stress and cellular damage .
NAD(P)H/NAD(P)+ Ratio Regulation: The activity of these enzymes influences the balance between reduced and oxidized forms of these cofactors, affecting numerous metabolic pathways dependent on these redox couples .
Cross-talk with Protein Folding Machinery: Several oxidoreductases form functional complexes with enzymes and chaperones involved in protein folding and quality control, suggesting integrated regulation of redox and proteostasis networks .
Research challenges in this area include developing methods to specifically measure oxidoreductase activity in intact organelles, distinguishing between different isoforms, and correlating enzyme activity with physiological outcomes.
Understanding the evolutionary relationships between different NAD(P)H-quinone oxidoreductases provides insights into their functional diversification and adaptation to various ecological niches. Current research suggests:
Structural Conservation with Functional Diversification: Core catalytic domains remain conserved across species, while substrate-binding regions show greater variability, reflecting adaptation to different quinone substrates encountered in different environments .
Specialized Isoforms: Many organisms possess multiple isoforms of these enzymes with specialized functions - some dedicated to detoxification pathways, others to energy metabolism .
Adaptation to Environmental Challenges: In organisms like Phytophthora capsici, these enzymes may have evolved specifically to detoxify defense compounds encountered during host invasion, contributing to pathogen virulence .
Research challenges include:
Comprehensive phylogenetic analysis of oxidoreductase sequences from diverse organisms
Correlation of sequence variations with functional differences
Understanding the selection pressures that have shaped the evolution of these enzymes
Post-translational modifications (PTMs) significantly influence protein structure, stability, localization, and activity. For NAD(P)H-quinone oxidoreductases, understanding the impact of PTMs represents an important research frontier:
N-linked Glycosylation: This modification is crucial for many proteins to achieve correct folding and native structure, particularly for membrane and secretory proteins . Some oxidoreductases may require glycosylation for optimal activity or stability.
Disulfide Bond Formation: Oxidoreductases involved in disulfide bond formation, isomerization, and reduction form functional complexes with enzymes and chaperones involved in protein folding .
Selenoprotein Incorporation: Some oxidoreductases are selenoproteins, containing the rare amino acid selenocysteine, which can significantly enhance catalytic activity compared to cysteine-containing counterparts .
Research methodological approach: Investigating PTMs requires a combination of mass spectrometry-based proteomics, site-directed mutagenesis of modification sites, and functional assays comparing native and modified forms of the enzyme. The recent development of chemical biology tools for specific PTM detection in living cells has significantly advanced this field.
Accurate measurement of NAD(P)H-quinone oxidoreductase activity is essential for understanding its role in cellular processes. The following analytical techniques offer complementary approaches:
| Technique | Principle | Advantages | Limitations |
|---|---|---|---|
| Spectrophotometric assays | Monitoring NAD(P)H oxidation at 340 nm | Real-time, simple, quantitative | Potential interference from other NAD(P)H-oxidizing enzymes |
| HPLC analysis | Separation and quantification of substrates/products | High specificity, can analyze multiple reactions | Time-consuming, requires specialized equipment |
| Enzyme-coupled assays | Linking oxidoreductase reaction to detectable signals | Can amplify signals for greater sensitivity | Potential complications from coupling enzymes |
| Oxygen consumption measurements | Monitoring O₂ consumption during enzymatic reaction | Direct measure of oxidation reactions | Not suitable for all oxidoreductase reactions |
For in vivo studies, researchers are increasingly employing:
Genetically encoded NAD(P)H sensors for real-time imaging
Metabolomics approaches to measure changes in quinone/hydroquinone ratios
Redox proteomics to assess the impact on cellular redox networks
Research methodological approach: The most robust studies typically employ multiple complementary techniques to overcome the limitations of any single method and provide cross-validation of activity measurements.
Computational modeling has emerged as a powerful tool for predicting enzyme-substrate interactions and understanding substrate specificity in NAD(P)H-quinone oxidoreductases:
Molecular Docking: Predicts how different quinone substrates might bind to the enzyme active site, estimating relative binding affinities and identifying key protein-substrate interactions .
Molecular Dynamics Simulations: Reveals the dynamic behavior of enzyme-substrate complexes, including transient interactions and conformational changes important for catalysis .
Quantum Mechanics/Molecular Mechanics (QM/MM): Essential for studying electron transfer processes that involve quantum mechanical effects not captured by classical simulations.
Structure-Based Virtual Screening: Screens large libraries of potential substrates or inhibitors in silico, identifying new compounds that might interact with the enzyme.
Research on P. capsici QOR demonstrates how computational simulation, combined with site-directed mutagenesis and enzymatic activity analysis, successfully identified the quinone-binding channel and key residues involved in substrate binding . This integrated approach provides more comprehensive understanding than any single method alone.
Analyzing structure-function relationships in large protein complexes like chromatophores presents significant challenges due to their size, complexity, and dynamic nature. Several statistical and computational approaches have proven valuable:
Multiscale Modeling: Combines atomic-level simulations with coarse-grained models to bridge different temporal and spatial scales relevant to chromatophore function .
Network Analysis: Treats protein components as nodes in a network, analyzing interactions and energy transfer pathways using graph theory to identify critical elements for function .
Principal Component Analysis: Identifies the most important collective motions in large molecular dynamics simulations, reducing dimensionality to focus on functionally relevant movements .
Comparative Statistical Analysis: When simulating chromatophores under different conditions (e.g., varying salt concentrations), statistical tests identify significant structural or functional differences .
The research on bacterial chromatophores described in the search results employed massive simulations (136 million atoms) running on supercomputers over four years. This scale of computation required specialized algorithms and statistical approaches to extract meaningful biological insights from the enormous datasets generated .