Recombinant NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Functional Role

ndhG encodes a transmembrane subunit of the chloroplast NAD(P)H dehydrogenase-like (NDH) complex. Key characteristics include:

PropertyDescription
Gene OriginTriticum aestivum (wheat), Lotus japonicus, and other plants
UniProt IDQ9MUL3 (wheat), Q8S8U6 (Arabidopsis), Q9BBP1 (Lotus japonicus)
Molecular Weight~21–22 kDa (calculated), but forms part of a 550 kDa multimeric complex
Subcellular LocalizationChloroplast thylakoid membrane
Primary FunctionElectron transfer from NAD(P)H to plastoquinone, coupled with proton translocation

The NDH complex comprises at least 16 subunits, with ndhG contributing to the membrane-embedded subcomplex involved in plastoquinone reduction . Its activity supports cyclic electron flow around Photosystem I and stress responses in plants .

Domain Architecture

  • Transmembrane Helices: ndhG contains multiple membrane-spanning regions critical for quinone binding .

  • Conserved Motifs: A Tyr-rich NAD(P)H-binding groove and Fe-S clusters facilitate electron transfer .

Enzymatic Activity

Purification studies using Arabidopsis thylakoids revealed:

  • Specific Activity: 0.39 μmol NADH oxidized/min/mg protein after anion-exchange chromatography .

  • Substrate Preference: NADH over NADPH (3:1 ratio) .

Table 1: Purification Yield of NDH Complex from Arabidopsis Thylakoids

StepTotal Protein (mg)Specific Activity (μmol/min/mg)Yield (%)
Thylakoid Membranes1,1000.065100
Dodecylmaltoside Extract4500.15100
Q-Sepharose HP Chromatography210.3956

Recombinant Production

Commercial variants are produced in E. coli with His-tags for affinity purification . Key specifications include:

  • Expression System: Cell-free or E. coli-based .

  • Sequence Coverage: Full-length (1–189 aa in wheat) .

  • Purity: >90% by SDS-PAGE .

  • Storage: Tris-based buffer with 50% glycerol at -80°C .

Mechanistic Studies

  • Electron Transport: Reconstitution assays demonstrate ndhG’s role in coupling NADH oxidation to plastoquinone reduction .

  • Proton Gradient Formation: Fluorescent probes quantify H+ translocation rates in proteoliposomes .

Challenges and Future Directions

Current limitations include low recombinant protein stability and incomplete structural resolution of the full NDH complex . Cryo-EM studies and site-directed mutagenesis (e.g., targeting conserved Tyr54 or Arg45 residues) are proposed to elucidate substrate-binding dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Mesostigma viride (Green alga)
Target Names
ndhG
Target Protein Sequence
MSFSEQIQNLSLLLLEIGTIIGALGVVLLPNILYSGFLLGGVLICIAGIYLLLNAEFIAA AQVLIYVGAINVIILFAIMLVNKIENLNPSNNQMMRNGLSSFICFSFFILLSNMIFDTQW IDTVGVSTKYSISIIGNHIFSDFLLPFEIVSVLLLVTLVGAVFIARKEDASEIEISKISF LNLPDPSKK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic and potentially chloroplast respiratory chains, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) and what is its primary function?

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) is a crucial component of the chloroplastic NAD(P)H dehydrogenase (NDH) complex, which plays a significant role in cyclic electron flow around photosystem I in plants. This protein is encoded by the chloroplast genome in most plants, including Amborella trichopoda as indicated in the available data . The primary function of ndhG involves electron transfer from NAD(P)H to plastoquinone, contributing to ATP synthesis without net production of NADPH. This process is particularly important under stress conditions when linear electron transport may be limited. The ndhG subunit is believed to be involved in the binding and orientation of the quinone substrate within the NDH complex, facilitating efficient electron transfer. Understanding this function is essential for researchers investigating photosynthetic mechanisms and stress responses in plants.

How can researchers verify the purity and functionality of recombinant ndhG protein preparations?

Verification of purity and functionality for recombinant NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) involves multiple analytical approaches. As indicated in the product information, SDS-PAGE analysis can confirm protein purity, with reliable preparations typically showing >85% purity . Beyond basic purity assessment, researchers should employ size exclusion chromatography to evaluate protein aggregation states, as improper folding often leads to aggregation and reduced functionality. Circular dichroism spectroscopy provides valuable information about secondary structure, confirming proper protein folding. For functional verification, enzyme activity assays measuring electron transfer from NAD(P)H to artificial electron acceptors such as ferricyanide or dichlorophenolindophenol (DCPIP) can quantify the catalytic competence of the recombinant protein. Mass spectrometry analysis should be conducted to verify protein identity and detect any unexpected post-translational modifications or truncations. Additionally, thermal shift assays can provide insights into protein stability, with properly folded ndhG showing characteristic melting curves. These complementary approaches together provide a comprehensive assessment of recombinant ndhG quality, ensuring reliable results in downstream experiments.

What are the optimal experimental design strategies for studying ndhG interactions with other NDH complex subunits?

The optimal experimental design strategy for studying NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) interactions with other NDH complex subunits requires a multifaceted approach. Researchers should first consider employing protein-protein interaction techniques with varying resolution levels. Co-immunoprecipitation experiments using tagged versions of ndhG (such as the biotinylated Avi-tag version mentioned in the product information) can identify interaction partners under near-native conditions . For more quantitative interaction data, surface plasmon resonance or isothermal titration calorimetry should be employed, allowing determination of binding affinities and thermodynamic parameters. The experimental design should incorporate appropriate controls, including interaction studies with mutated versions of ndhG to identify specific residues involved in subunit binding. Cross-linking mass spectrometry offers another powerful approach, providing spatial constraints for protein-protein interactions within the complex. Following the principles of optimal experimental design discussed in the literature, researchers should consider a sequential approach that maximizes information gain with each experiment . This would involve starting with methods that give an overview of all potential interaction partners, followed by focused validation experiments for specific interactions of interest. Statistical power calculations should guide sample sizing to ensure detection of biologically relevant interaction differences.

How should researchers design experiments to investigate the role of ndhG in response to environmental stressors?

Designing experiments to investigate NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) responses to environmental stressors requires careful consideration of multiple variables. Researchers should implement a factorial experimental design that examines multiple stressors (e.g., drought, high light, temperature extremes) individually and in combination, as these often occur simultaneously in natural environments. Control and treatment groups should be clearly defined, with appropriate biological replicates (minimum n=4 per condition) to account for natural variation in plant responses. Time-course experiments are essential, as ndhG regulation may show both rapid (minutes to hours) and adaptive (days to weeks) responses to stress conditions. Molecular analyses should include quantification of ndhG transcript levels, protein abundance, post-translational modifications, and NDH complex assembly status under different stress regimes. Physiological measurements, including chlorophyll fluorescence parameters (particularly parameters sensitive to cyclic electron flow) should be paired with molecular data to link ndhG regulation with functional outcomes. Following principles from experimental design literature, researchers should consider using response surface methodology to model how ndhG responses vary across continuous stress gradients rather than discrete treatment levels . This approach can identify thresholds where ndhG regulation significantly changes, providing deeper insights into its role in stress adaptation mechanisms.

What statistical approaches are most appropriate for analyzing ndhG functional data with high variability?

When analyzing functional data for NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) that exhibits high variability, researchers should employ robust statistical approaches that account for heterogeneity while maximizing inferential power. Mixed-effects models are particularly valuable for accommodating both fixed experimental factors and random effects that capture batch-to-batch variation in protein preparation or biological replicates. For experiments comparing multiple conditions, researchers should avoid simple t-tests in favor of ANOVA frameworks with appropriate post-hoc corrections for multiple comparisons (such as Tukey's HSD or Bonferroni correction). Non-parametric alternatives like Kruskal-Wallis tests should be considered when data violate normality assumptions. For dealing with outliers, which are common in enzyme kinetic studies, robust regression methods can provide more reliable parameter estimates than ordinary least squares approaches. As suggested in the experimental design literature, researchers might consider retrospective designed sampling approaches when faced with large, heterogeneous datasets . This involves selecting optimal subsets of data points based on a specific utility function related to the research question, potentially increasing statistical power compared to analyzing all available data. Bayesian statistical frameworks offer another valuable approach, particularly for integrating prior knowledge about ndhG function with new experimental data, and for quantifying uncertainty in parameter estimates in a more nuanced way than traditional confidence intervals.

How can researchers effectively incorporate ndhG sequence variations across species in comparative functional studies?

Incorporating NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) sequence variations across species in comparative functional studies requires a methodical phylogenetics-informed approach. Researchers should begin by conducting comprehensive sequence alignments of ndhG from diverse plant lineages, identifying conserved domains and variable regions that may relate to functional differences or evolutionary adaptations. Ancestral sequence reconstruction techniques should be employed to infer the evolutionary trajectory of ndhG and identify key mutations that coincided with major plant adaptations. For functional testing, researchers should select representative species from different evolutionary lineages (e.g., Amborella trichopoda as a basal angiosperm, as mentioned in the product information) rather than arbitrary or convenience-based sampling . Recombinant protein expression should be standardized across all selected variants, ideally using the same expression system to minimize system-specific effects on protein function. Chimeric proteins, where domains from different species are swapped, can help pinpoint regions responsible for functional differences. Enzyme kinetic parameters (Km, Vmax, catalytic efficiency) should be systematically compared across variants under identical experimental conditions. Statistical analysis should account for phylogenetic non-independence of species data, using methods such as phylogenetic independent contrasts or phylogenetic generalized least squares. This approach allows researchers to distinguish between functional differences due to shared evolutionary history versus independent adaptations to similar environmental pressures.

How should researchers approach contradictory data in ndhG functional studies across different model systems?

When confronted with contradictory data in NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) functional studies across different model systems, researchers should implement a systematic reconciliation approach. The first step involves detailed documentation of methodological differences between studies, including expression systems (yeast, E. coli, baculovirus, or mammalian cells as mentioned in the product information), purification protocols, assay conditions, and analytical techniques . Researchers should then conduct controlled comparative experiments using standardized protocols across multiple model systems to determine whether contradictions arise from biological differences or methodological variations. Meta-analysis techniques can be valuable for quantitatively assessing the extent of contradiction and identifying patterns across studies. For instance, while absolute activity values may differ between systems, trends in response to experimental variables might remain consistent. Structural and biochemical analyses should be employed to investigate system-specific post-translational modifications or protein-protein interactions that might explain functional differences. Researchers must consider the possibility that contradictions reflect genuine biological complexity rather than experimental artifacts, as ndhG may have context-dependent functions. Following principles from experimental design literature, Bayesian statistical approaches are particularly valuable in this context, allowing integration of prior knowledge with new data and explicit modeling of between-study heterogeneity . When reporting results, researchers should transparently discuss contradictions and provide interpretations that accommodate apparently conflicting observations, avoiding the tendency to selectively emphasize data that support a preferred hypothesis.

How can researchers effectively integrate transcriptomic, proteomic, and functional data to build comprehensive models of ndhG regulation?

Integrating transcriptomic, proteomic, and functional data for comprehensive modeling of NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) regulation requires sophisticated multi-omics approaches. Researchers should begin with temporal alignment of datasets, ensuring that samples across different platforms represent comparable biological states. Correlation analysis between ndhG transcript levels, protein abundance, and functional measurements can identify potential post-transcriptional and post-translational regulatory mechanisms. Network analysis approaches, including weighted gene co-expression network analysis (WGCNA), can identify groups of genes and proteins whose expression patterns correlate with ndhG, suggesting potential co-regulatory relationships. Causal inference techniques, such as dynamic Bayesian networks, should be employed to move beyond correlation and establish likely regulatory relationships directing ndhG expression and function. For effective integration, researchers should consider dimensionality reduction techniques such as principal component analysis or t-SNE to identify major patterns across multi-omics datasets. Following experimental design principles from the literature, researchers might implement Bayesian hierarchical modeling to account for different noise characteristics and reliability across data types . Validation of integrated models should include targeted experimental perturbations (e.g., mutation of predicted regulatory elements) followed by measurement of effects across all data types. When interpreting integrated models, researchers should acknowledge technology-specific biases and limitations, distinguishing between strongly and weakly supported regulatory connections. The final integrated model should specify both direct regulators of ndhG expression/function and broader regulatory networks that respond to environmental conditions relevant to NDH complex activity.

What are the most promising applications of ndhG research in improving plant stress tolerance?

Research on NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) offers several promising applications for improving plant stress tolerance through enhanced cyclic electron flow regulation. Genetic engineering approaches targeting ndhG could involve overexpression of optimized variants with improved stability or activity, potentially enhancing cyclic electron flow capacity during stress conditions. Site-directed mutagenesis of specific ndhG residues, informed by structural and functional studies using recombinant proteins like those described in the product information, could create variants with altered regulatory properties or substrate affinities . Genome editing technologies such as CRISPR-Cas9 enable precise modification of endogenous ndhG sequences, avoiding the complications associated with transgene expression. Beyond direct modification of ndhG itself, research might target transcription factors or post-translational modification enzymes that regulate ndhG expression or activity. Creation of synthetic regulatory circuits that modulate ndhG expression in response to specific stress conditions represents another advanced application, potentially allowing for dynamic optimization of cyclic electron flow based on environmental inputs. For traditional breeding applications, identification of natural ndhG variants associated with enhanced stress tolerance could provide valuable markers for selection programs. Following principles from experimental design literature, researchers should employ factorial experimental designs testing modified plants under multiple stress conditions simultaneously, as this better represents natural environments than single-stress approaches . Field testing under realistic conditions is essential, as laboratory-observed enhancements in ndhG function may have different impacts in complex environments where multiple stressors interact.

How can big data approaches enhance our understanding of ndhG evolution and function across plant species?

Big data approaches offer transformative opportunities for understanding NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) evolution and function across the plant kingdom. Researchers should leverage the rapidly expanding repository of plant genome sequences to conduct comprehensive phylogenomic analyses of ndhG, mapping sequence changes against major evolutionary transitions in photosynthetic mechanisms. Machine learning algorithms applied to sequence data can identify subtle patterns of co-evolution between ndhG and other NDH complex components, suggesting functional interactions that might not be apparent through conventional analyses. Data mining of publicly available transcriptome datasets across diverse plant species and conditions can reveal conserved and divergent regulatory patterns, providing insights into how ndhG regulation has evolved. Meta-analysis of proteomics datasets can identify conserved post-translational modifications and protein-protein interactions. For effective implementation of these approaches, researchers should follow experimental design principles from the literature, particularly regarding retrospective designed sampling when working with heterogeneous big datasets . This involves selecting optimal subsets of data based on specific research questions rather than analyzing all available data simultaneously. Statistical approaches should account for phylogenetic relationships when comparing across species, using methods such as phylogenetic generalized least squares. Integration of multimodal data (genomic, transcriptomic, proteomic, metabolomic) through network-based approaches can provide a systems-level understanding of ndhG function across evolutionary lineages. The resulting insights can guide the design of targeted experimental studies using recombinant proteins from key species, such as the Amborella trichopoda ndhG mentioned in the product information .

What methodological advances are needed to better understand the structural dynamics of ndhG within the NDH complex?

Advancing our understanding of NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) structural dynamics within the NDH complex requires several methodological innovations. Time-resolved cryo-electron microscopy represents a frontier technique that could capture multiple conformational states of ndhG during the catalytic cycle, providing insights into dynamic changes that facilitate electron transfer. Development of site-specific spectroscopic probes, potentially utilizing the biotinylated Avi-tag versions of recombinant ndhG mentioned in the product information, would enable real-time monitoring of local conformational changes in specific domains . Advanced hydrogen-deuterium exchange mass spectrometry with improved temporal resolution could map changes in solvent accessibility during substrate binding and catalysis. For understanding ndhG interactions within the larger complex, protein crosslinking approaches combined with mass spectrometry and computational modeling can generate distance constraints that inform structural models. Single-molecule FRET experiments using fluorescently labeled ndhG could provide unprecedented insights into conformational dynamics at the individual molecule level, revealing heterogeneity that might be masked in ensemble measurements. Following principles from experimental design literature, researchers should employ Bayesian experimental design approaches to optimize these technically challenging experiments, maximizing information gain from limited or noisy data . Integration of experimental structural data with molecular dynamics simulations at appropriate timescales is essential, as the dynamic nature of ndhG function cannot be fully captured by static structural approaches alone. Development of nanodiscs or other membrane mimetics that better replicate the native lipid environment of the NDH complex would ensure that observed structural dynamics reflect physiologically relevant conditions rather than artifacts of detergent solubilization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.