Recombinant Na (+)/H (+) antiporter subunit B1

Shipped with Ice Packs
In Stock

Description

Introduction to Na+/H+ Antiporters

Na+/H+ antiporters are essential integral membrane proteins widely distributed in cell membranes from bacteria to animals. These transporters mediate the exchange of Na+ or Li+ ions for H+ across cytoplasmic membranes, utilizing electrochemical potential gradients as driving forces for this exchange . In bacteria, these antiporters extrude Na+ or Li+ in exchange for H+, driven by an electrochemical potential of H+ established either by the respiratory chain or H+-translocating ATPase . Conversely, in animal cells, these transporters (often called exchangers) extrude H+ in exchange for Na+, driven by an electrochemical potential of Na+ established by the Na+,K+-ATPase .

Physiological Functions of Na+/H+ Antiporters

Na+/H+ antiporters serve multiple crucial functions in bacterial cells:

  • Establishment of electrochemical Na+ potential across cytoplasmic membranes, which drives Na+-coupled processes including Na+/solute symport and Na+-driven flagellar rotation

  • Extrusion of Na+ and Li+ ions, which are toxic at high intracellular concentrations

  • Regulation of intracellular pH, particularly under alkaline conditions

  • Cell volume regulation during osmotic stress

These antiporters are essential for the survival of many bacteria, particularly in environments with fluctuating pH and salt concentrations. In pathogens like Yersinia pestis, Na+/H+ antiporters have been shown to be indispensable for virulence .

Multisubunit Na+/H+ Antiporters: A Novel Class

While many Na+/H+ antiporters consist of a single protein with approximately 12 transmembrane domains, research has identified multisubunit Na+/H+ antiporter complexes that represent a novel class of these transporters.

The Multisubunit Na+/H+ Antiporter from Staphylococcus aureus

In a groundbreaking study, researchers identified a multisubunit Na+/H+ antiporter from Staphylococcus aureus that consists of seven different subunits encoded by an operon . This discovery revealed an entirely new structural organization for these transporters. The seven open reading frames (ORFs) necessary for antiporter function were designated as the mnh operon, with individual genes labeled as mnhA through mnhG .

The necessity of all seven subunits for functional Na+/H+ antiport activity was demonstrated through deletion analysis. When any of the subunits was missing, the antiporter lost its ability to confer salt tolerance to host cells . This finding contrasts sharply with previously characterized Na+/H+ antiporters like NhaA, NhaB, and ChaA from Escherichia coli, which consist of single proteins of approximately 1.5 kbp in length .

The Recombinant Na+/H+ Antiporter Subunit B1: Current Understanding

Based on the available research, Subunit B1 appears to be one of the essential components in multisubunit Na+/H+ antiporter complexes. While specific information about this particular subunit is limited in the provided sources, we can infer several important aspects about its likely characteristics and functions.

Potential Role in the Multisubunit Complex

As part of a multisubunit complex, Subunit B1 likely contributes to:

  • The formation of the ion translocation pathway across the membrane

  • Substrate specificity for Na+ and Li+ ions

  • pH-dependent regulation of antiporter activity

  • Structural stability of the antiporter complex

Recombinant Expression and Purification Approaches

Recombinant production of membrane proteins like Na+/H+ antiporter subunits presents significant challenges but offers valuable research opportunities. Similar to other Na+/H+ antiporters that have been successfully produced as recombinant proteins, the following approaches are likely applicable to Subunit B1:

  • Expression in bacterial systems like E. coli, particularly in strains lacking endogenous Na+/H+ antiporters to facilitate functional complementation studies

  • Purification using affinity tags and detergent solubilization

  • Reconstitution into proteoliposomes for functional characterization

Functional Characteristics of Na+/H+ Antiporters

Understanding the general functional characteristics of Na+/H+ antiporters provides insights into the likely properties of Subunit B1 as part of a multisubunit complex.

Transport Stoichiometry and Electrophysiology

Na+/H+ antiporters display varying transport stoichiometries depending on their specific type:

  • NhaA family transporters typically operate with a 1Na+/2H+ stoichiometry, making them electrogenic

  • NhaB transporters function with a 2Na+/3H+ stoichiometry

  • Solid-supported membrane-based electrophysiological measurements can detect the negative currents associated with electrogenic Na+/H+ antiport activity

The stoichiometry directly impacts the energy efficiency of the antiporter and its ability to generate or dissipate ion gradients across membranes.

pH-Dependent Regulation

A distinctive feature of Na+/H+ antiporters is their pH-dependent activity profile:

  • E. coli NhaA shows dramatically increased transport activity between pH 7.0 and 8.5

  • Transport activity of some antiporters declines above pH 8.5, possibly due to H+ substrate depletion at highly alkaline pH values

  • Species-specific differences in pH profiles exist, such as NhaA from Helicobacter pylori being active between pH 6.0 and 8.5

This pH-dependent regulation is crucial for the antiporter's physiological function in maintaining pH homeostasis under various environmental conditions.

Substrate Specificity

Na+/H+ antiporters exhibit varying degrees of ion selectivity:

  • Most bacterial Na+/H+ antiporters show high selectivity for Na+ and Li+ ions

  • Recent studies have suggested that selectivity may arise not from binding specificity but from later steps in the transport cycle

  • K+ typically does not affect Na+ affinity or transport of substrate cations

The mechanisms underlying substrate specificity remain an active area of research, with implications for understanding the specialized functions of individual subunits in multisubunit complexes.

Comparative Analysis with Other Na+/H+ Antiporter Types

To better understand the context of multisubunit Na+/H+ antiporters containing Subunit B1, it is valuable to compare them with other well-characterized antiporter types.

Comparison with NhaA Family Transporters

The NhaA family represents one of the best-characterized groups of Na+/H+ antiporters:

  • NhaA consists of a single protein with 12 transmembrane α-helices organized in a unique fold

  • Three conserved aspartate residues (D133, D163, and D164) are critical for function in E. coli NhaA

  • NhaA functions as a homodimer, with each subunit forming an independent transport pathway

  • The transport reaction catalyzed is: Na+(in) + 2H+(out) ⇌ Na+(out) + 2H+(in)

Multisubunit antiporters likely employ different structural arrangements to achieve similar functional outcomes, with specialized subunits potentially taking on roles analogous to different domains in single-protein antiporters.

Vacuolar-Type Na+/H+ Antiporters

Vacuolar-type Na+/H+ antiporters, particularly in plants, represent another important class:

  • These transporters play crucial roles in salt stress tolerance by sequestering Na+ into vacuoles

  • In bread wheat, three different vacuolar-type Na+/H+ antiporter genes (TaNHXa, TaNHXb, and TaNHXc) have been identified

  • These transporters have distinct structural features compared to bacterial antiporters

Understanding these differences provides insights into how various organisms have evolved different antiporter systems to meet their specific physiological needs.

Applications and Significance

The recombinant production and study of Na+/H+ antiporter subunits, including Subunit B1, have significant implications for various fields.

Biotechnological Applications

Recombinant Na+/H+ antiporter subunits could be utilized in:

  • Development of salt-tolerant crop plants through genetic engineering

  • Bioremediation applications in high-salinity environments

  • Creation of biosensors for monitoring Na+ concentrations or pH

Biomedical Relevance

Understanding bacterial Na+/H+ antiporters has implications for:

  • Development of novel antimicrobial strategies targeting these essential transporters

  • Understanding pathogen survival mechanisms in host environments

  • Potentially addressing antibiotic resistance through novel drug targets

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please communicate your request in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference point for your preparations.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
mnhB1; mrpB1; Na(+/H(+ antiporter subunit B1; Mnh complex subunit B1; Mrp complex subunit B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhB1
Target Protein Sequence
MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE
Uniprot No.

Target Background

Function
The Mnh complex functions as a Na(+)Li(+)/H(+) antiporter, playing a role in Na(+) and/or Li(+) excretion. Na(+)/H(+) antiport utilizes a transmembrane electrical potential and is therefore considered electrogenic. It does not transport K(+), Ca(2+) or Mg(2+).
Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Na+/H+ antiporters in bacterial systems?

Na+/H+ antiporters exhibit remarkable structural diversity across species. In Staphylococcus aureus, a multisubunit Na+/H+ antiporter system has been identified comprising seven open reading frames (ORFs) that form an operon. These subunits (designated mnhA to mnhG) function together as a novel type of multisubunit antiporter . This contrasts with the single-protein antiporters found in other bacterial species such as the NhaA, NhaB, and ChaA systems in Escherichia coli. The multisubunit structure suggests complex coordination between subunits for ion transport and regulation.

What are the primary physiological roles of Na+/H+ antiporters in bacterial cells?

Na+/H+ antiporters serve several critical functions in bacterial physiology:

  • Establishment of an electrochemical potential of Na+ across the cytoplasmic membrane, which drives Na+-coupled processes including Na+/solute symport and Na+-driven flagellar rotation

  • Extrusion of toxic Na+ and Li+ ions from the cytoplasm

  • Regulation of intracellular pH, particularly under alkaline conditions

  • Cell volume regulation during osmotic stress

These functions make Na+/H+ antiporters essential for bacterial survival in diverse environments, especially those with high salinity or alkaline pH.

How are subunit interactions organized in multisubunit Na+/H+ antiporter complexes?

In multisubunit Na+/H+ antiporters like the Mrp system, subunit interactions are critical for both complex assembly and function. Research has demonstrated that the C-terminal region of the MrpA subunit plays a crucial role in interactions with other subunits, particularly MrpB and MrpC . Mutations in this region, such as MrpA-P683G, can disrupt complex formation while still retaining Na+/H+ antiport activity, indicating distinct structural and functional domains within the protein complex . The organization follows a specific pattern where all subunits assemble into a functional complex, with no internal promoters or terminators between ORFs, suggesting coordinated expression and assembly .

What techniques are most effective for measuring Na+/H+ antiporter activity in reconstituted systems?

Reconstitution systems provide powerful approaches for studying antiporter function in controlled environments. An effective method involves:

  • Extraction of membrane proteins using detergents such as octylglucoside

  • Reconstitution into liposomes composed of appropriate lipids (alkalophile lipids for alkaliphilic bacteria)

  • Loading proteoliposomes with radioactive 22Na+

  • Measuring Na+ efflux against its electrochemical gradient using a valinomycin-mediated potassium diffusion potential

This approach allows researchers to characterize key properties of the antiporter including electrogenic transport, pH sensitivity, ion specificity, and apparent affinity for Na+. Successful reconstitution depends critically on maintaining the native lipid environment and proper protein orientation in the liposome membrane .

How can expression systems be optimized for producing functional recombinant Na+/H+ antiporter subunits?

When expressing recombinant Na+/H+ antiporter subunits, particularly from multisubunit complexes, several factors must be considered:

  • Co-expression of all necessary subunits is often required for proper complex formation

  • Maintaining the native operon structure whenever possible preserves natural stoichiometry

  • Selection of expression hosts with appropriate membrane composition and protein folding machinery

  • Careful choice of affinity tags to minimize interference with subunit interactions

  • Optimization of induction conditions to prevent aggregation and misfolding

For the Mrp complex specifically, studies have shown that all seven subunits (MrpA-G) must be expressed for full functional activity, as deletion of any single subunit typically results in loss of antiporter function .

What are the key residues in antiporter subunits that determine ion selectivity and transport?

Specific conserved residues in Na+/H+ antiporter subunits play critical roles in ion binding and transport. For subunit B1 and related proteins, several key observations emerge from mutation studies:

SubunitCritical ResiduesFunctional ImpactReference
MrpAE687, E778Essential for Na+/H+ antiport activity
MrpAH230, H700, P702Adjacent to charged residues essential for activity; affects Km for Na+
MrpDE137Essential for antiport activity
MrpDF136Adjacent to essential E137; affects Km for Na+

These findings suggest that acidic residues (glutamate) are particularly important for ion binding and transport, while adjacent residues modify the affinity for Na+ and influence the transport mechanism .

How do mutations in MrpB (subunit B) affect complex formation versus antiport function?

Mutations in MrpB, particularly at position P37 (MrpB-P37G), produce a fascinating phenotype: Na+/H+ antiport activity is maintained, but the mutation prevents detection of the complete Mrp complex monomer in Blue Native PAGE analysis . This suggests that while this residue is critical for stable complex formation, its mutation doesn't completely abolish the functional interaction between subunits. Similar phenotypes are observed with mutations in other subunits (MrpA-P677G and MrpC-Q70A), indicating that distinct residues throughout the complex contribute to stable assembly without directly affecting the ion transport mechanism .

What are the current models explaining ion transport pathways through multisubunit Na+/H+ antiporters?

Two predominant models have been proposed for ion transport in multisubunit Na+/H+ antiporters based on structural and functional studies:

Model 1: MrpA functions as the Na+ transport pathway, while MrpD serves as the H+ pathway operating in the opposite direction. This model is supported by complementation studies showing that NuoL (a complex I subunit homologous to MrpA) complements MrpA deficiency, while NuoN complements MrpD deficiency .

Model 2: Each of the MrpA and MrpD subunits contains a H+ pathway, while the interface between these subunits forms a Na+ transport pathway. This model is based on homology modeling from crystal structures of complex I subunits. Specifically, the interface between transmembrane region 5 of MrpA and transmembrane region 12 of MrpD is proposed to form the Na+ transport pathway .

Both models identify the conserved glutamic acid residues in the NDH-1 motif as critical cation binding sites.

How does the stoichiometry of Na+/H+ exchange vary across different antiporter systems?

The stoichiometry of Na+/H+ exchange is a critical parameter that determines whether transport is electroneutral or electrogenic. For the reconstituted bacterial Na+/H+ antiporter from Bacillus firmus RAB, the transport is electrogenic, as evidenced by its dependence on an electrical potential . In mammalian NHE1, the exchange appears to follow a Monod-Wyman-Changeux mechanism where the functional unit is a dimer with each protomer having one site for Na+ and one site for H+ . This dimeric model explains the cooperative response to changes in intracellular pH. The multisubunit Mrp system likely has a different stoichiometry, though detailed characterization remains an active area of investigation.

How do phosphorylation and dephosphorylation events regulate Na+/H+ exchanger activity?

Post-translational modifications, particularly phosphorylation, play crucial roles in regulating Na+/H+ exchanger activity. In the mammalian Na+/H+ exchanger NHE1, phosphorylation of threonine residue T779 increases antiporter activity, while specific dephosphorylation by the Ser/Thr phosphatase calcineurin (CN) reduces activity . This represents a key regulatory mechanism in pH homeostasis.

The phosphorylation state of these exchangers is often dynamically controlled by multiple kinases and phosphatases in response to various cellular signals including growth factors, hormones, and stress conditions. For bacterial multisubunit antiporters, phosphorylation-based regulation is less well characterized but may involve similar mechanisms .

What molecular mechanisms explain the pH-dependent activation of Na+/H+ antiporters?

Na+/H+ antiporters typically show pH-dependent activation, with increased activity at alkaline pH for many bacterial antiporters and at acidic intracellular pH for mammalian NHE1. For NHE1, a Monod-Wyman-Changeux allosteric mechanism has been proposed to explain this behavior . In this model:

  • The NHE1 functional unit exists as a dimer

  • Each protomer contains one site for Na+ and one site for H+

  • The dimer oscillates between low-affinity and high-affinity forms for H+

  • At physiological pH, the low-affinity form predominates, resulting in minimal activity

  • Decreased intracellular pH shifts the equilibrium toward the high-affinity form, increasing activity

Mutations that alter this pH sensitivity (such as those with altered Hill coefficients) are thought to lock the antiporter into one conformation of this allosteric mechanism .

How can structural information about Na+/H+ antiporter subunits inform drug discovery efforts?

Understanding the structure-function relationships of Na+/H+ antiporters, particularly the key residues involved in ion binding and transport, provides valuable targets for drug discovery. For bacterial systems, the multisubunit nature of Mrp antiporters offers unique opportunities:

  • The interfaces between subunits represent potential binding sites for small molecules that could disrupt complex formation

  • Ion transport pathways formed between subunits (as in Model 2 for Mrp) present specialized targets that might not exist in human antiporters

  • Conserved glutamic acid residues in the NDH-1 motif that function as cation binding sites could be targeted specifically

Since Na+/H+ antiporters are essential for bacterial survival in various environments, inhibitors of these systems could represent novel antibiotics, particularly against alkaliphilic pathogens or those inhabiting high-salt environments .

What are the implications of altered Na+/H+ antiporter function in bacterial adaptation to extreme environments?

Na+/H+ antiporters play crucial roles in bacterial adaptation to extreme environments, particularly those with high salinity or alkaline pH. The multisubunit Mrp antiporters are particularly important in diverse bacteria and archaea for managing these stresses . Research has shown that:

  • Bacteria lacking functional Na+/H+ antiporters show severely impaired growth in high salt conditions

  • Antiporter activity is often enhanced at alkaline pH, suggesting a specific role in pH homeostasis under these conditions

  • Expression of antiporter genes is typically upregulated during salt or alkaline stress

These findings suggest that Na+/H+ antiporters represent a critical adaptation mechanism and may have been important drivers of bacterial diversification into extreme ecological niches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.