Recombinant Na (+)/H (+) antiporter subunit C1

Shipped with Ice Packs
In Stock

Description

Protein Classification and Nomenclature

The Na(+)/H(+) antiporter subunit C1 is also known by alternative names including "Mnh complex subunit C1" and "Mrp complex subunit C1" . These nomenclatures reflect its membership in the multisubunit Na(+)/H(+) antiporter complex, which represents a novel type of cation/proton exchange system in bacteria. The protein is identified in the UniProt database with the accession number P60682, indicating its recognition as a distinct and characterized protein entity .

Genetic Organization

The gene encoding Na(+)/H(+) antiporter subunit C1 (mnhC1) is part of a larger operon structure. Research has demonstrated that this operon contains seven open reading frames (ORFs) that are necessary and sufficient for Na(+)/H(+) antiporter function . The complete operon, designated as mnh, includes genes mnhA through mnhG, with mnhC1 being one of the essential components . Genetic analysis has revealed that a promoter-like sequence exists upstream of the first ORF, while an inverted repeat followed by a T-cluster, potentially functioning as a terminator, is found downstream from the seventh ORF .

Functional Roles of Na(+)/H(+) Antiporter Systems

Na(+)/H(+) antiporter systems, of which subunit C1 is a critical component, serve multiple essential functions in bacterial physiology. Understanding these functions provides context for the specific roles of the C1 subunit within the larger complex.

Primary Physiological Functions

The multisubunit Na(+)/H(+) antiporter complex performs several critical roles in bacterial cells:

  1. Establishment of an electrochemical potential of Na+ across the cytoplasmic membrane, which drives Na+-coupled processes such as solute symport and flagellar rotation

  2. Extrusion of Na+ and Li+ ions, which can be toxic if accumulated at high concentrations within cells

  3. Regulation of intracellular pH, particularly under alkaline conditions

  4. Cell volume regulation during osmotic stress

These functions underscore the antiporter's importance in bacterial adaptation to environmental stresses, particularly in conditions of high salinity or pH fluctuations.

Distinctive Features of the Multisubunit Complex

Unlike other well-characterized Na(+)/H(+) antiporters such as NhaA, NhaB, and ChaA from Escherichia coli, which typically consist of a single protein with approximately 12 transmembrane domains encoded by genes of about 1.5 kbp, the Na(+)/H(+) antiporter from S. aureus requires seven distinct subunits for functionality . This multisubunit composition represents a novel architectural approach to ion transport machinery in prokaryotes.

The activity profile of this antiporter also distinguishes it from other known systems. The S. aureus Na(+)/H(+) antiporter exhibits activity at pH 7.0, whereas the NhaA-type antiporters (the principal Na(+)/H(+) antiporters of E. coli and V. parahaemolyticus) typically show negligible activity at pH 7.0 but high activity at pH 8.5 . This functional difference suggests distinct mechanisms of action and regulatory control.

Experimental Evidence and Research Findings

Scientific investigations have provided significant insights into the function and properties of the Na(+)/H(+) antiporter complex containing subunit C1.

Functional Complementation Studies

Research has demonstrated that E. coli cells harboring plasmids for the cloned mnh genes (including mnhC1) from S. aureus were able to grow in medium containing 0.2 M NaCl or 10 mM LiCl, while host cells without these plasmids failed to grow under the same conditions . This functional complementation provides strong evidence for the role of the antiporter complex in salt tolerance.

Membrane Vesicle Studies

Na(+)/H(+) antiport activity has been directly detected in membrane vesicles prepared from transformants expressing the mnh genes. These studies revealed measurable Na(+)/H(+) exchange at pH 7.0, along with weaker Li(+)/H(+) antiport activity . The antiport activities observed at neutral pH further distinguish this system from NhaA-type antiporters.

Deletion Analysis

Experimental deletion studies have yielded crucial insights into the functional organization of the mnh operon. When various deletion plasmids were constructed and introduced into antiporter-deficient E. coli cells, researchers found that most (approximately 6 kbp) of the DNA insert carried on the original plasmid was necessary for growth in the presence of 0.2 M NaCl . Moreover, deletion of internal portions eliminated salt tolerance, confirming the requirement for the intact operon .

Recombinant Production and Research Applications

The recombinant expression of Na(+)/H(+) antiporter subunit C1 has facilitated detailed studies of this protein and the broader antiporter complex.

Research Applications

Recombinant Na(+)/H(+) antiporter subunit C1 finds applications in several research contexts:

  1. Structural studies to determine the three-dimensional organization of the protein and its positioning within the multisubunit complex

  2. Functional assays to assess binding properties, transport kinetics, and regulatory mechanisms

  3. Interaction studies to identify binding partners and regulatory factors

  4. Antibody production for immunolocalization and immunoprecipitation experiments

These applications contribute to a deeper understanding of bacterial membrane transport systems and their roles in microbial physiology and pathogenesis.

Comparison with Other Na(+)/H(+) Antiporter Systems

The multisubunit Na(+)/H(+) antiporter containing subunit C1 represents a distinct class of ion transport systems when compared to other characterized antiporters.

Functional Divergence

The S. aureus Na(+)/H(+) antiporter complex exhibits activity at neutral pH (pH 7.0), whereas other well-characterized antiporters such as E. coli NhaA show minimal activity at this pH but high activity under alkaline conditions (pH 8.5) . This functional difference may reflect adaptations to specific physiological demands or environmental niches.

Evolutionary Implications

The existence of a multisubunit Na(+)/H(+) antiporter suggests evolutionary diversity in ion transport mechanisms among bacteria. The complex architecture may provide additional regulatory control points or functional versatility compared to single-subunit transporters.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
mnhC1; mrpC1; Na(+/H(+ antiporter subunit C1; Mnh complex subunit C1; Mrp complex subunit C1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhC1
Target Protein Sequence
MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD
Uniprot No.

Target Background

Function
Mnh complex is a Na(+)/Li(+)/H(+) antiporter involved in Na(+) and/or Li(+) excretion. Na(+)/H(+) antiport consumes a transmembrane electrical potential, thus being inferred as electrogenic. It does not transport K(+), Ca(2+) or Mg(2+).
Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Na(+)/H(+) antiporter and what are its primary functions in cellular physiology?

Na(+)/H(+) antiporters are integral membrane proteins that catalyze the exchange of H(+) for Na(+) across cellular membranes. These transporters play several crucial roles in bacterial cells:

  • Establishment of electrochemical potential of Na(+) across the cytoplasmic membrane, which drives Na(+)-coupled processes such as Na(+)/solute symport and Na(+)-driven flagellar rotation

  • Extrusion of Na(+) and Li(+), which can be toxic at high intracellular concentrations

  • Intracellular pH regulation, particularly under alkaline conditions

  • Cell volume regulation

The specific Na(+)/H(+) antiporter subunit C1 is part of a multisubunit antiporter complex, which represents a more complex architecture compared to single-protein antiporters like NhaA, NhaB, or ChaA found in organisms such as E. coli.

How are multisubunit Na(+)/H(+) antiporters organized genetically and structurally?

Multisubunit Na(+)/H(+) antiporters, such as those found in Staphylococcus aureus, represent a novel class of transporters with complex organization:

  • Genetic structure: Seven open reading frames (ORFs) have been identified as necessary for antiporter function in S. aureus

  • Operon arrangement: These genes typically form an operon with a promoter-like sequence upstream of the first ORF and a terminator-like sequence after the seventh ORF

  • Coordinated expression: Neither terminator-like nor promoter-like sequences are found between the ORFs, suggesting coordinated expression of all subunits

  • Functional requirement: All seven subunits appear necessary for complete antiporter function, indicating a complex structural organization

For recombinant expression of subunit C1, it's critical to understand its position and role within this multisubunit complex to ensure proper folding and function when expressed independently.

What methods are used to measure Na(+)/H(+) antiporter activity in experimental systems?

Several established methodologies are used to assess Na(+)/H(+) antiporter activity:

Everted Membrane Vesicle Assay

This technique directly measures ion transport activity:

  • Preparation of everted membrane vesicles from cells expressing the antiporter

  • Monitoring pH changes using fluorescent dyes like acridine orange

  • Addition of substrate (e.g., succinate) to initiate respiration and establish a pH gradient

  • Addition of NaCl to enable Na(+)/H(+) antiport activity

  • Quantification of dye fluorescence changes (dequenching) as a measure of antiporter activity

Growth Assays in High-Salt Medium

This approach tests physiological function:

  • Cells expressing the antiporter are cultured in medium containing high concentrations of NaCl (e.g., 0.2 M) or LiCl (e.g., 10 mM)

  • Growth capability is compared to control cells without the antiporter

  • This assesses the antiporter's ability to support salt tolerance

Michaelis-Menten Analysis

For quantitative kinetic characterization:

  • Measurement of transport activity at varying Na(+) concentrations

  • Determination of apparent Km and Vmax values

  • Comparison of kinetic parameters across different antiporters or under different conditions

AntiporterOrganismKm for Na+ (pH 7.5)Km for Na+ (pH 8.5)
NhaPP. aeruginosa6.7 ± 0.6 mM~1 mM
NhaP2P. aeruginosa11 ± 2 mM~1 mM
NhaBP. aeruginosa<1 mM<1 mM

How does pH affect Na(+)/H(+) antiporter activity and what are the physiological implications?

Na(+)/H(+) antiporters show distinct pH-dependent activity profiles that reflect their physiological roles:

  • pH-dependent activity: Different antiporter types show varying pH optima and sensitivity

  • NhaA-type antiporters: Activity is not measurable at pH 7.0 but very high at pH 8.5, making them specialized for alkaline pH regulation

  • S. aureus multisubunit antiporter: Shows activity at pH 7.0, suggesting a different pH profile than NhaA-type transporters

  • P. aeruginosa antiporters: Show varying apparent Na(+) affinities at different pH values, with NhaP and NhaP2 having higher affinity (lower Km) at pH 8.5 compared to pH 7.5

These pH-dependent characteristics are critical for physiological function:

  • Intracellular pH homeostasis: Na(+)/H(+) antiporters participate in pH regulation by exchanging external Na(+) for internal H(+)

  • Adaptive response: The varying pH dependencies of different antiporter types may allow bacteria to regulate pH across a range of environmental conditions

What ion specificities are observed in different Na(+)/H(+) antiporter systems?

Na(+)/H(+) antiporters display varying ion specificities:

  • Na(+) transport: All Na(+)/H(+) antiporters transport Na(+) ions, but with different affinities

  • Li(+) transport: Some antiporters, such as NhaB from P. aeruginosa, show significant Li(+)/H(+) antiporter activity

  • K(+) transport: Dedicated K(+)/H(+) antiporter systems exist separately from Na(+)/H(+) antiporters

  • Selective mutations: Studies of MelB (melibiose permease) show that mutation of specific residues can dramatically alter ion selectivity, such as the D59C mutation which changes the symporter to a uniporter

The ion specificity is determined by the coordination geometry of the binding site:

  • In MelB, Na(+) is coordinated by four side chains (Asp55, Asn58, Asp59, and Thr121) at distances of 2.1-2.8 Å

  • Specific residues like Thr121 are critical for Na(+) but not H(+) or Li(+) binding

What expression systems and purification strategies are optimal for recombinant Na(+)/H(+) antiporter subunit C1?

Successful expression and purification of membrane proteins like Na(+)/H(+) antiporter subunit C1 requires careful consideration of several factors:

Expression Systems

  • Bacterial systems: E. coli strains deficient in native Na(+)/H(+) antiporters (such as KNabc) provide a clean background for functional studies

  • Co-expression considerations: For multisubunit antiporters, co-expression of partner subunits may be necessary for proper folding and stability

  • Advanced expression hosts: Insect cells or mammalian expression systems may provide better membrane protein folding environments for structural studies

Purification Strategy

  • Membrane preparation: Careful isolation of membrane fractions is essential before solubilization

  • Detergent screening: Testing multiple detergents for optimal extraction and stability (DDM, LMNG, etc.)

  • Affinity tags: Strategic placement of affinity tags (His, FLAG) to avoid disrupting function

  • Quality control: Size exclusion chromatography to ensure homogeneity and assess oligomeric state

  • Functional verification: Reconstitution into proteoliposomes to confirm activity of the purified protein

Methodological Considerations

When working with subunit C1 from a multisubunit complex:

  • Expression of the complete antiporter complex may be necessary for stability of individual subunits

  • Domain analysis to identify stable, independently folding domains

  • Assessment of stability and functionality when expressed separately from other subunits

How do the molecular dynamics of ion binding and transport operate in Na(+)/H(+) antiporters?

Recent structural and functional studies have revealed sophisticated mechanisms for ion binding and transport:

Ion Binding Sites

  • Critical coordination residues: Aspartic acid residues form the core of Na(+) binding sites

  • The "ND motif": A conserved asparagine-aspartate motif is essential for function, with mutations reducing proton efflux by approximately 3-fold

  • Backbone contributions: Carbonyl oxygens of residues like Thr214 and Ser240 can contribute to Na(+) coordination

  • Water molecules: Often participate in completing the coordination sphere around bound ions

Transport Mechanisms

  • Elevator mechanism: The transport domain moves vertically relative to dimerization domains

  • Mobile barrier: In MelB, a mobile barrier mechanism has been identified for cation-coupled symport

  • Conformational changes: MD simulations reveal that the Na(+)-binding site can remain largely unchanged between inward-facing and outward-facing states, facilitating reversible transport

pH-Dependent Regulation

  • Salt bridge formation: In electrogenic Na(+)/H(+) antiporters, a salt bridge forms between an aspartic acid and a lysine residue

  • Protonation states: Simulations suggest that specific aspartate residues must be deprotonated for Na(+) binding to occur

What structure-function relationships determine the kinetic properties of different Na(+)/H(+) antiporters?

Structure-function analyses reveal several determinants of antiporter kinetics:

Structural Determinants of Affinity

  • Coordination geometry: The precise arrangement of coordinating residues affects Na(+) affinity

  • In P. aeruginosa, different antiporter variants show dramatically different apparent Km values for Na(+) :

    • NhaB: <1 mM at both pH 7.5 and 8.5

    • NhaP: 6.7 ± 0.6 mM at pH 7.5, ~1 mM at pH 8.5

    • NhaP2: 11 ± 2 mM at pH 7.5, ~1 mM at pH 8.5

pH-Dependent Activity Modulation

  • All four P. aeruginosa Na(+)/H(+) antiporters are functionally different despite catalyzing the same reaction

  • pH dependence varies significantly between antiporter types:

    • NhaP and NhaP2 show higher affinity for Na(+) at pH 8.5 than at pH 7.5

    • NhaB maintains high affinity across pH ranges

    • NhaA-type antiporters are inactive at pH 7.0 but highly active at pH 8.5

Experimental Approaches for Kinetic Characterization

  • Site-directed mutagenesis of key residues to assess their contribution to kinetics

  • Fluorescence-based transport assays using pH-sensitive dyes

  • Michaelis-Menten analysis to determine kinetic parameters

  • Isothermal titration calorimetry to directly measure binding affinities

How can cryo-EM and computational approaches advance our understanding of multisubunit Na(+)/H(+) antiporter complexes?

Modern structural biology and computational approaches offer powerful tools for studying complex membrane transporters:

Cryo-EM Advantages for Multisubunit Complexes

  • No crystallization requirement: Bypasses difficulties in crystallizing membrane protein complexes

  • Heterogeneity analysis: Can sort particles based on conformational states

  • Multiple conformations: Potential to capture different stages of the transport cycle

  • Native-like environment: Samples can be prepared in lipid nanodiscs to maintain a near-native lipid environment

MD Simulation Applications

  • Ion pathway mapping: Simulations can identify the pathways of ions through the transporter

  • In NHE9, MD simulations revealed that Na(+) interacts with Asp244 and backbone carbonyl oxygen atoms of Thr214 and Ser240, as well as water molecules

  • Conformational dynamics: Modeling transitions between states to understand the transport mechanism

  • Energy landscapes: Calculating energy barriers for different steps in the transport cycle

  • Protonation effects: Modeling how changing protonation states affect structure and function

Integrative Structural Biology

  • Combining cryo-EM with:

    • Crosslinking mass spectrometry to map subunit interactions

    • Hydrogen-deuterium exchange to identify dynamic regions

    • Molecular dynamics simulations to model conformational changes

    • Functional assays to correlate structure with activity

What are the experimental challenges and solutions in measuring ion transport kinetics of recombinant Na(+)/H(+) antiporter subunit C1?

Accurate measurement of ion transport kinetics presents specific challenges:

Methodological Challenges

  • Orientation in reconstituted systems: Ensuring uniform orientation in proteoliposomes

  • Background activity: Eliminating contributions from endogenous transporters

  • Signal-to-noise ratio: Optimizing assay sensitivity for accurate measurements

  • Time resolution: Capturing rapid transport events

Advanced Solutions

  • Proteoliposome-based assays:

    • Controlled lipid composition to mimic native environment

    • Incorporation of fluorescent dyes for real-time monitoring

    • Addition of ionophores to dissipate competing gradients

  • Electrophysiological approaches:

    • Patch-clamp of reconstituted systems

    • Solid-supported membrane electrophysiology

  • Isotope flux measurements:

    • Using 22Na+ to directly measure Na+ transport

    • Rapid filtration techniques for time-resolved measurements

Data Analysis Frameworks

  • Global fitting approaches to complex kinetic models

  • Discrimination between transport models (sequential, random, ping-pong)

  • Correction for factors affecting apparent kinetics:

    • Membrane potential effects

    • pH gradient effects

    • Substrate/ion competition effects

What strategies can address protein instability when expressing recombinant Na(+)/H(+) antiporter subunit C1?

Membrane protein instability is a common challenge that requires systematic approaches:

Stabilization Strategies

  • Fusion partners: Addition of well-folding domains like GFP, MBP or SUMO

  • Thermostabilizing mutations: Introduction of disulfide bonds or surface mutations

  • Co-expression with partner subunits: For multisubunit complexes, co-expression may enhance stability

  • Lipid environment optimization: Screening different lipids during purification and storage

Technical Troubleshooting

  • Expression temperature optimization: Lower temperatures often improve folding

  • Detergent screening: Testing mild detergents (DDM, LMNG) versus harsh detergents (SDS)

  • Additive screening: Addition of specific lipids, cholesterol, or stabilizing compounds

  • Construct optimization: Testing various N- and C-terminal truncations

Practical Workflow

  • Start with multiple constructs with varying boundaries

  • Screen expression conditions systematically

  • Assess protein quality using fluorescence-detection size-exclusion chromatography (FSEC)

  • Optimize purification protocol based on thermostability measurements

  • Validate functionality using transport assays

How can researchers distinguish the contributions of individual subunits in multisubunit Na(+)/H(+) antiporters?

Isolating the functions of individual subunits requires specialized approaches:

Genetic Approaches

  • Complementation analysis: Transform antiporter-deficient strains with plasmids expressing different combinations of subunits

  • Deletion analysis: Systematic deletion of individual subunits to assess their contribution to function

  • Point mutations: Site-directed mutagenesis of predicted functional residues in specific subunits

Biochemical Approaches

  • Subunit-specific antibodies: To detect expression and localization

  • Crosslinking studies: To identify interacting regions between subunits

  • Reconstitution experiments: With purified individual subunits to assess minimal functional units

What is the recommended approach for analyzing contradictory kinetic data from different Na(+)/H(+) antiporter studies?

Researchers frequently encounter seemingly contradictory results when comparing antiporter studies:

Sources of Variation

  • Experimental conditions: Differences in pH, temperature, ionic strength

  • Membrane composition: Variations in lipid environment between studies

  • Expression systems: Different hosts may process proteins differently

  • Protein variants: Subtle sequence differences or fusion tags

  • Measurement techniques: Different sensitivities and time resolutions

Reconciliation Strategy

  • Standardize experimental conditions where possible

  • Directly compare different antiporters in the same experimental setup

  • Consider the physiological context of each antiporter

  • Account for differences in expression levels when comparing activities

  • Perform careful statistical analysis of replicate measurements

Case Study Analysis

As demonstrated in P. aeruginosa studies, even closely related antiporters can show dramatically different kinetic properties:

  • NhaP and NhaP2 show pH-dependent changes in Na(+) affinity

  • NhaB maintains high affinity across pH ranges

  • Different antiporters show distinct ion selectivity profiles

These differences likely reflect evolutionary adaptations to specific physiological roles rather than experimental artifacts.

How should researchers approach the functional characterization of recombinant Na(+)/H(+) antiporter subunit C1 in heterologous systems?

Functional characterization in heterologous systems requires careful experimental design:

Expression System Selection

  • E. coli KNabc strain: Lacks three major Na(+)/H(+) antiporters, providing a clean background

  • Alternative hosts: Consider P. pastoris or mammalian cells for complex proteins

  • Inducible expression: Tight control to prevent toxicity from overexpression

Functional Assays

  • Growth complementation: Testing whether the expressed protein restores growth under high salt conditions

  • Transport measurements: Direct assessment of Na(+)/H(+) exchange activity using everted membrane vesicles

  • pH sensitivity: Characterization of activity across a range of pH values

  • Ion specificity: Testing transport of different ions (Na(+), Li(+), K(+))

Controls and Validations

  • Empty vector controls: Essential to establish baseline

  • Positive controls: Well-characterized antiporters with known properties

  • Inactive mutants: Mutations in key residues as negative controls

  • Expression verification: Western blotting to confirm expression levels

  • Localization: Membrane fractionation to confirm proper targeting

How might synthetic biology approaches enhance our understanding of Na(+)/H(+) antiporter subunit C1?

Synthetic biology offers innovative approaches to study and engineer antiporters:

Domain Swapping and Chimeras

  • Exchange domains between different antiporter types to identify functional modules

  • Create chimeric transporters with novel properties

  • Map the minimal functional units required for transport

Protein Engineering Applications

  • Designer antiporters with altered ion specificity

  • pH sensors based on antiporter conformational changes

  • Biosensors for monitoring intracellular Na(+) levels

  • Synthetic circuits incorporating antiporters for ionic homeostasis

Research Opportunities

  • Creation of minimal functional antiporters

  • Engineering antiporters with enhanced transport rates

  • Development of antiporters with novel ion selectivity profiles

  • Design of light-controlled or ligand-gated antiporters

What insights can be gained from comparing bacterial and mammalian Na(+)/H(+) antiporter systems?

Evolutionary comparisons reveal fundamental principles of antiporter function:

Structural Conservation and Divergence

  • Bacterial multisubunit systems (like the seven-subunit Mnh complex) versus mammalian NHE family members

  • Shared mechanistic features despite sequence divergence

  • Specialized adaptations to different cellular environments

Functional Adaptations

  • pH sensitivity: Bacterial antiporters often function at higher pH ranges than mammalian counterparts

  • Regulatory mechanisms: Mammalian systems show more complex regulation via phosphorylation and protein-protein interactions

  • Physiological roles: Renal NHE3 plays crucial roles in acid-base balance in mammals

Therapeutic Relevance

  • Understanding bacterial antiporters could inform development of novel antimicrobials

  • Insights into mammalian NHE function has implications for diseases involving pH dysregulation

What are the most promising methodological advances for studying conformational changes during Na(+)/H(+) antiport?

Cutting-edge techniques offer new windows into antiporter dynamics:

Time-Resolved Structural Methods

  • Time-resolved cryo-EM: Capturing transient intermediate states

  • Single-molecule FRET: Monitoring distance changes between domains during transport

  • Hydrogen-deuterium exchange mass spectrometry: Mapping regions with changing solvent accessibility

Computational Approaches

  • Enhanced sampling simulations: Accelerating the observation of rare conformational changes

  • Markov state modeling: Building kinetic models of the transport cycle

  • Machine learning approaches: Identifying patterns in conformational data

Functional Dynamics

  • Voltage-clamp fluorometry: Correlating conformational changes with transport events

  • Stopped-flow spectroscopy: Measuring kinetics of conformational changes

  • Nanobody-based conformational stabilization: Trapping specific transport states for structural analysis

These approaches could reveal how subunit C1 contributes to the conformational cycle of the complete antiporter complex.

What are the key unanswered questions regarding Na(+)/H(+) antiporter subunit C1?

Despite significant advances in understanding Na(+)/H(+) antiporters, several critical questions remain regarding subunit C1:

  • Structural organization: How does subunit C1 integrate into the full multisubunit complex?

  • Functional contribution: What specific role does subunit C1 play in the transport mechanism?

  • Evolutionary conservation: How conserved is subunit C1 across bacterial species compared to other subunits?

  • Regulatory mechanisms: How is the activity of subunit C1 regulated within the complex?

  • Interaction network: Which other subunits directly contact subunit C1?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.