Recombinant Na (+)/H (+) antiporter subunit E1

Shipped with Ice Packs
In Stock

Description

MrpE: A Critical Subunit in Na⁺/H⁺ Antiporters

MrpE is essential for the stability and function of the Mrp complex. Its deletion or mutation severely impairs antiporter activity.

Functional Roles

  • Ion Pathway Contribution: MrpE may facilitate Na⁺ entry into the transporter’s cytoplasmic cavity, as suggested by its proximity to conserved histidines (e.g., H131, H32) in structural models .

  • Primary vs. Secondary Transport: In alkaliphilic bacteria, MrpE enables the Mrp complex to function as a primary Na⁺/H⁺ antiporter under low ΔpH, generating a Na⁺ motive force .

Research Findings on MrpE Mutations

Mutational studies highlight MrpE’s indispensable role in Na⁺/H⁺ antiport activity.

MutationEffect on ActivityImpact on Kₘ (Na⁺)Reference
P114G (MrpE)Severe reduction in antiporter activityIncreased K
T113A (MrpE)Complete loss of antiporter functionN/A
ΔMrpE (Deletion)~90% loss of activity; residual functionN/A

Key Observations:

  • P114G Mutation: Disrupts Na⁺ binding, increasing the apparent Kₘ for Na⁺, indicating a role in substrate affinity .

  • Thinning Membrane Regions: MrpE’s cytoplasmic loop (e.g., Pro114) may interact with the membrane’s thinned regions, facilitating Na⁺ entry .

Comparative Analysis of Antiporter Subunits

The Mrp complex’s subunits exhibit functional specialization, contrasting with simpler antiporters like NhaA (single-subunit).

FeatureMrp ComplexNhaA (E. coli)
Subunits7 (A–G)1
Ion TransportNa⁺ and H⁺ pathways in separate subunitsSingle pathway for Na⁺/H⁺
pH SensitivityModerate (e.g., MrpA’s loop VIII-IX)High (e.g., NhaA’s pH-dependent activity)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your convenience.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that tag.
Synonyms
mnhE1; mrpE1; Na(+/H(+ antiporter subunit E1; Mnh complex subunit E1; Mrp complex subunit E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhE1
Target Protein Sequence
MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
Uniprot No.

Target Background

Function
Mnh complex is a Na(+)Li(+)/H(+) antiporter involved in Na(+) and/or Li(+) excretion. Na(+)/H(+) antiport utilizes transmembrane electrical potential and is therefore considered electrogenic. It does not transport K(+), Ca(2+) or Mg(2+).
Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the primary physiological roles of Na(+)/H(+) antiporters in bacterial cells?

Na(+)/H(+) antiporters serve multiple critical functions in bacterial physiology:

  • Establishment of electrochemical potential of Na+ across the cytoplasmic membrane, which drives Na+-coupled processes including Na+/solute symport and Na+-driven flagellar rotation

  • Extrusion of toxic Na+ and Li+ ions that could otherwise accumulate to harmful levels

  • Regulation of intracellular pH, particularly under alkaline conditions

  • Maintenance of cell volume homeostasis

These functions make Na(+)/H(+) antiporters essential for bacterial survival under various stress conditions, including high salinity and alkaline environments . Recent research has demonstrated that these transporters can be particularly important for pathogenic bacteria, as deletion of major Na(+)/H(+) antiporters in organisms like Yersinia pestis renders them significantly less virulent .

How do multisubunit Na(+)/H(+) antiporters differ from single-protein antiporters?

While many characterized Na(+)/H(+) antiporters consist of a single protein (such as NhaA, NhaB, and ChaA in E. coli), multisubunit antiporters represent a distinct structural and functional class:

FeatureSingle-Protein AntiportersMultisubunit Antiporters
StructureOne polypeptide chainMultiple distinct subunits
Genetic organizationSingle geneOperon of multiple genes
ExamplesNhaA, NhaB, ChaA (E. coli)Mnh system (S. aureus)
Typical size30-60 kDaCombined weight of all subunits
Functional assemblySingle proteinComplex of multiple proteins

The S. aureus multisubunit Na(+)/H(+) antiporter consists of seven distinct subunits (MnhA through MnhG) encoded by an operon with no terminator-like or promoter-like sequences between the genes . This complex organization suggests a more intricate structure-function relationship and potentially more sophisticated regulatory mechanisms compared to single-protein antiporters.

What distinguishes the different types of Na(+)/H(+) antiporters in terms of ion selectivity and pH dependence?

Na(+)/H(+) antiporters demonstrate significant variation in substrate specificity and pH-dependent activity:

  • Ion selectivity: While all Na(+)/H(+) antiporters transport Na+, some show strict selectivity for Na+ and Li+ (like E. coli NhaA), while others can also transport K+ (such as certain NhaC-type antiporters) .

  • pH dependence: Antiporters exhibit species-specific pH activity profiles. E. coli NhaA shows dramatically increased activity between pH 7.0 and 8.5, with activity declining above pH 8.5. In contrast, S. enterica NhaA maintains high activity above pH 8.5, and some NhaC-type antiporters from extremophiles demonstrate activity across a broader pH range (7.0-10.0) .

  • Stoichiometry: Different antiporters exchange ions at different ratios. For example, NhaA has a 1Na+/2H+ stoichiometry, while NhaB operates with a 2Na+/3H+ ratio .

These differences likely reflect evolutionary adaptations to specific environmental niches and physiological requirements of different bacterial species.

What expression systems are most effective for recombinant Na(+)/H(+) antiporter subunits?

For recombinant expression of Na(+)/H(+) antiporter subunits, the choice of expression system is critical:

E. coli-based expression systems:

  • E. coli mutant strains lacking endogenous Na(+)/H(+) antiporters (e.g., KNabc strain lacking nhaA, nhaB, and chaA) provide an ideal background for functional characterization .

  • For multisubunit antiporters, vectors allowing co-expression of multiple genes from a single promoter (like polycistronic vectors) are preferable.

  • The pET vector system with T7 promoters offers high expression levels for biochemical and structural studies.

Methodological approach:

  • Clone the complete antiporter operon or individual subunit genes into appropriate vectors with compatible promoters

  • Transform into antiporter-deficient E. coli strains (e.g., KNabc)

  • Verify expression through growth complementation assays on high-sodium media

  • Optimize expression conditions (temperature, inducer concentration, growth media)

  • Scale up for protein purification as needed

For subunit E1 specifically, co-expression with other operon components may be necessary to ensure proper folding and stability, as multisubunit antiporters often require assembly of the complete complex for function .

How can researchers verify successful expression and membrane integration of recombinant antiporter subunits?

Verification of expression and proper membrane integration requires multiple approaches:

Functional complementation assays:

  • Transform antiporter genes into Na+/H+-antiporter deficient strains (e.g., E. coli KNabc)

  • Test growth on media containing high concentrations of NaCl (e.g., 0.2-0.7 M) or LiCl (10-40 mM)

  • Compare growth rates at different pH values to determine the pH-dependence profile

Biochemical verification methods:

  • Western blotting with antibodies against tags (His, FLAG) or the protein itself

  • Membrane fractionation to confirm localization in the membrane fraction

  • Fluorescent fusion proteins to visualize membrane localization

  • Proteoliposome reconstitution followed by functional assays

For multisubunit antiporters, verifying the correct assembly of all subunits presents additional challenges. Co-immunoprecipitation experiments using tags on different subunits can help confirm proper complex formation .

What purification strategies are most effective for membrane-bound Na(+)/H(+) antiporter subunits?

Purification of membrane proteins like Na(+)/H(+) antiporter subunits requires specialized approaches:

Recommended purification workflow:

  • Membrane preparation: Harvest cells, disrupt by sonication or French press, and isolate membrane fraction through differential centrifugation

  • Solubilization: Extract membrane proteins using appropriate detergents (DDM, LDAO, or Triton X-100)

  • Affinity chromatography: Utilize affinity tags (His-tag commonly used) for initial purification

  • Size exclusion chromatography: Separate monomers/oligomers and remove aggregates

  • Ion exchange chromatography: Further purify based on charge properties

Critical considerations:

  • Detergent selection is crucial - too harsh detergents may disrupt subunit interactions

  • For multisubunit complexes, tandem affinity purification with tags on different subunits may improve complex integrity

  • Assess protein homogeneity through size-exclusion chromatography combined with multi-angle laser light scattering (SEC-MALLS) to determine the oligomeric state accurately, as performed for S. enterica NhaA which was determined to exist as a dimer in solution

Maintaining the native oligomeric state is particularly important for multisubunit antiporters, as improper assembly will lead to loss of function .

What are the most reliable methods to measure Na(+)/H(+) antiporter activity in recombinant systems?

Several complementary approaches can be used to measure antiporter activity:

Fluorescence-based assays:

  • Prepare everted membrane vesicles from cells expressing the antiporter

  • Load vesicles with pH-sensitive fluorescent dyes (e.g., acridine orange)

  • Establish a pH gradient using respiratory substrates (e.g., D-lactate)

  • Monitor fluorescence dequenching upon addition of Na+, Li+, or K+

  • Calculate relative activity by measuring the ratio of dequenching fluorescence after adding various ion concentrations

Electrophysiological measurements:

  • Reconstitute purified antiporter into proteoliposomes

  • Perform solid-supported membrane-based electrophysiological measurements

  • Record currents in response to ion gradients to determine stoichiometry and transport kinetics

Direct ion flux measurements:

  • Use radioactive isotopes (22Na+) to measure transport rates

  • Alternatively, employ ion-selective electrodes to monitor ion fluxes

When characterizing subunits of multisubunit antiporters, it's crucial to determine whether individual subunits possess activity or if the complete complex is required for function .

How can researchers determine the stoichiometry and ion selectivity of recombinant Na(+)/H(+) antiporters?

Determining stoichiometry and ion selectivity requires specialized methodologies:

Stoichiometry determination:

  • Electrophysiological measurements with reconstituted proteoliposomes can measure current magnitude and direction

  • For example, negative currents recorded for S. enterica NhaA were consistent with a 1Na+(Li+)/2H+ stoichiometry

  • Alternatively, compare pH changes with ion fluxes under controlled conditions

Ion selectivity assessment:

  • Measure antiport activity using different cations (Na+, Li+, K+)

  • Determine apparent Km values for each cation using concentration-dependent activity assays

  • Perform competition experiments to assess whether different ions compete for the same binding site

  • For example, K+ was found not to affect Na+ affinity in S. enterica NhaA, indicating selectivity arises at the substrate binding step

pH dependence profiling:

  • Measure activity across a range of pH values (typically pH 6.0-10.0)

  • Plot relative activity versus pH to determine optimal pH and regulatory characteristics

  • Compare profiles between wild-type and mutant proteins to identify pH-sensing residues

These characterizations are essential for understanding the mechanistic basis of transport and regulatory properties of the antiporter.

How do mutations in conserved residues affect the function of Na(+)/H(+) antiporter subunits?

Mutagenesis studies have revealed critical functional residues in Na(+)/H(+) antiporters:

Key functional residues identified in NhaD-type antiporters:

  • Substitutions S150A, D154G, N155A, N189A, D199A, T201A, T202A, S389A, N394G, S428A, and S431A completely abolished Na+-dependent H+ transport

  • Mutations T157A and S428A significantly increased apparent Km values for alkali cations

  • Of six conserved histidine residues, only mutations in His-93 and His-210 affected Na+(Li+)/H+ antiport

Experimental approach for mutagenesis studies:

  • Identify conserved residues through sequence alignment of homologous antiporters

  • Create site-directed mutants (alanine scanning is commonly used)

  • Express mutants in antiporter-deficient strains

  • Test growth complementation under high salt conditions

  • Measure antiport activity in membrane vesicles

  • Determine kinetic parameters (Km, Vmax) for different substrates

  • Assess pH-dependent activity profiles

How can structural information be obtained for multisubunit Na(+)/H(+) antiporters?

Obtaining structural information for multisubunit membrane protein complexes presents significant challenges:

Complementary structural biology approaches:

MethodAdvantagesLimitationsApplication to Antiporters
X-ray CrystallographyHigh resolution (2-3Å)Requires stable crystalsRevealed EcNhaA structure and transport mechanism
Cryo-EMWorks with smaller amounts of protein; captures different conformationsLower resolution for smaller complexesSuitable for multisubunit complexes
NMR SpectroscopyCan detect dynamic regionsLimited to smaller proteinsUseful for individual domains or subunits
Cross-linking Mass SpectrometryMaps subunit interactionsLow resolutionIdentifies subunit arrangement
HDX-MSProbes conformational dynamicsIndirect structural informationDetects pH-induced conformational changes

Methodological considerations for multisubunit antiporters:

  • Co-expression and co-purification of all subunits is critical

  • Stabilization of the complex may require specific lipids or inhibitors

  • Nanodiscs or amphipols can maintain native-like membrane environment

  • Fusion constructs may help stabilize interactions between subunits

The X-ray structure of E. coli NhaA has provided valuable insights into antiporter mechanism, revealing a unique fold and potential Na+ binding sites . Similar approaches could be applied to multisubunit antiporters, though their greater complexity presents additional challenges.

What approaches can resolve contradictory data regarding pH-dependent regulation of Na(+)/H(+) antiporters?

Resolving contradictions in pH-dependent regulation requires systematic investigation:

Two competing models exist:

  • Cytosolic pH-sensor model: Proposes specific residues act as pH sensors to regulate activity

  • Kinetic competition model: Suggests Na+ and H+ compete for common binding sites, with pH effects arising from substrate availability

Experimental approaches to resolve contradictions:

  • Use asymmetric pH conditions (different pH on each side of the membrane) to differentiate between models

  • Perform mutagenesis of putative pH-sensing residues and measure effects on pH profile

  • Determine ion binding using isothermal titration calorimetry under different pH conditions

  • Measure transport kinetics (Km, Vmax) as a function of pH

  • Compare pH profiles across homologs from different species with varying physiological pH ranges

Recent research on S. enterica NhaA shows it maintains high activity above pH 8.5, unlike E. coli NhaA where activity declines. This suggests species-specific differences in pH regulation mechanisms . Species-specific adaptations may explain seemingly contradictory results between different antiporter homologs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.