Recombinant Na (+)/H (+) antiporter subunit G1

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Origin

Recombinant Na+^+/H+^+ antiporter subunit G1 is a heterologously expressed protein derived from bacterial operons, such as the mnh operon in Staphylococcus aureus. Key features include:

  • Species Origin: Primarily Staphylococcus aureus (UniProt ID: P60698) and Staphylococcus haemolyticus (UniProt ID: Q4L4W1) .

  • Expression System: Produced in Escherichia coli with an N-terminal His tag for purification .

  • Sequence: Comprises 118 amino acids (e.g., S. aureus sequence: MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYFIATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL) .

2.1. Role in Na+^+/H+^+ Antiporter Complexes

Subunit G1 is part of a seven-subunit Na+^+/H+^+ antiporter complex (e.g., mnhA–mnhG operon in S. aureus) that facilitates:

  • Electrogenic Na+^+ Extrusion: Driven by proton gradients generated via respiration or ATPase activity .

  • pH Homeostasis: Critical for bacterial survival under alkaline conditions by countering intracellular alkalization .

  • Salt Tolerance: Enables growth in high NaCl or LiCl concentrations (e.g., 0.2–2.0 M NaCl) .

4.1. Functional Validation

  • Heterologous Expression: E. coli expressing recombinant subunit G1 gains salt tolerance (0.2 M NaCl) and Na+^+/H+^+ antiport activity in membrane vesicles .

  • pH-Dependent Activity:

    • At pH 7.5–9.0: Mediates Na+^+ extrusion .

    • At pH 10: Supports pH homeostasis under low Na+^+ conditions .

4.2. Mechanistic Studies

  • Respiratory Coupling: Na+^+ extrusion is sensitive to H+^+ conductors, confirming antiport (not pump) activity .

  • Subunit Interactions: Works with other subunits (e.g., MrpA, MrpD) to form ion pathways, as inferred from homologs in Bacillus and archaea .

Applications and Implications

  • Biotechnological Uses: Engineering salt-tolerant microbes for industrial processes (e.g., bioremediation, biofuel production) .

  • Drug Target Potential: Disrupting ion homeostasis in pathogenic Staphylococcus strains could aid antimicrobial development .

Limitations and Future Directions

  • Structural Data: High-resolution structures of the full complex are lacking, necessitating cryo-EM studies .

  • In Vivo Roles: Gene knockout studies in native hosts (e.g., S. aureus) are needed to clarify subunit-specific contributions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhG1; mrpG1; Na(+/H(+ antiporter subunit G1; Mnh complex subunit G1; Mrp complex subunit G1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhG1
Target Protein Sequence
MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
Uniprot No.

Target Background

Function
The Mnh complex is a Na(+)Li(+)/H(+) antiporter involved in Na(+) and/or Li(+) excretion. Na(+)/H(+) antiport consumes a transmembrane electrical potential, thus implying its electrogenic nature. It does not transport K(+), Ca(2+) or Mg(2+).
Protein Families
CPA3 antiporters (TC 2.A.63) subunit G family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Na(+)/H(+) antiporter subunit G1?

The Na(+)/H(+) antiporter subunit G1 refers to a specific sodium/proton exchange protein identified in multiple bacterial species. In alkaliphilic Bacillus sp. G1, the g1-nhaC gene encodes a Na(+)/H(+) antiporter consisting of 535 amino acids with a calculated molecular mass of 57,776 Da . Similar antiporter proteins have been identified in other organisms including Staphylococcus aureus (P60698) . These membrane transport proteins facilitate the exchange of sodium ions for protons across cell membranes, which is essential for maintaining ionic balance and pH regulation within cells.

How does the Na(+)/H(+) antiporter function in cellular pH homeostasis?

The Na(+)/H(+) antiporter maintains pH homeostasis through selective ion exchange across membranes. Research with g1-NhaC from Bacillus sp. G1 shows it functions differently depending on environmental conditions: at lower pH values (pH 8.0-9.0), it primarily functions in Na(+) extrusion, while at higher alkaline conditions (pH 10), it plays a more significant role in pH homeostasis, particularly under Na(+)-limiting conditions (0.2M NaCl) . This dual functionality allows organisms to thrive in challenging environments with varying pH and salt concentrations. The antiporter exchanges sodium ions from inside the cell for protons from outside, effectively regulating both intracellular sodium concentration and pH simultaneously.

What are the differences between Na(+)/H(+) antiporter variants across bacterial species?

Na(+)/H(+) antiporter variants show significant functional and regulatory differences across bacterial species. In E. coli, two major antiporter systems have been identified: nhaA and nhaB. While nhaA activity increases considerably at pH levels above 8.0, nhaB activity exhibits no pH dependence in the range between pH 7.0 and 8.5 . In contrast, the g1-NhaC antiporter from alkaliphilic Bacillus sp. G1 shows distinct functionality at different pH ranges, with significant activity at high alkaline conditions . These differences reflect evolutionary adaptations to specific ecological niches. Additionally, the importance of these transporters varies between species - while E. coli nhaB mutants grow normally on media containing 0.5M NaCl, nhaA mutants show sensitivity to the same salt concentration, indicating functional specialization .

How does the expression of recombinant Na(+)/H(+) antiporter affect salt tolerance in heterologous systems?

Expression of recombinant Na(+)/H(+) antiporter significantly enhances salt tolerance in heterologous systems. When the g1-nhaC gene from alkaliphilic Bacillus sp. G1 was cloned into pET22b(+) and expressed in Escherichia coli BL21 (DE3), the recombinant bacteria demonstrated remarkable salt tolerance compared to wild-type cells . These transformed E. coli cells grew well in medium with NaCl concentrations as high as 1.75M at pH 8.0-9.0, with minimal growth observed at 2.0M NaCl . The enhanced salt tolerance results from the Na(+) extrusion function of the antiporter, which prevents toxic accumulation of sodium ions within the cytoplasm. The salt tolerance profile varies with pH, demonstrating the complex relationship between pH regulation and sodium ion transport through these antiporters.

What are the critical amino acid residues involved in Na(+)/H(+) antiporter function?

Research on sodium/proton exchangers has identified several critical amino acid residues essential for antiporter function. While specific information about g1-NhaC is limited in the search results, studies on related transporters like Nhx1p provide valuable insights. In Nhx1p, mutations at positions D201N, E225Q, and D230N completely abolished function while preserving proper protein expression and localization . These aspartate and glutamate residues, which are negatively charged, likely form part of the ion binding sites or transport pathway. Different from these critical residues, the E355Q mutation in Nhx1p had no effect on transport function . This suggests that not all acidic residues are equally important for antiporter activity. The specific arrangement of these charged residues likely determines ion selectivity and transport kinetics in Na(+)/H(+) antiporters.

What cellular phenotypes result from Na(+)/H(+) antiporter mutations or deficiencies?

Na(+)/H(+) antiporter mutations or deficiencies produce distinct cellular phenotypes depending on the specific antiporter and organism. In yeast studies, deletion of the NHX1 gene (encoding a sodium/proton exchanger) resulted in significant protein trafficking defects, including mislocalization of proteins like Vps10p, Vph1p, and Pep12p . These cells accumulated the endocytic dye FM4-64 in an aberrant class E-like compartment adjacent to the vacuole, indicating disrupted endosomal function . In E. coli, mutations in the nhaB gene dramatically reduced Na(+)/H(+) antiporter activity compared to wild-type cells, while nhaA deletion strains showed hypersensitivity to 0.5M NaCl despite normal antiporter activity at neutral pH . These observations highlight the diverse cellular roles of Na(+)/H(+) antiporters beyond simple ion exchange, including protein trafficking, endosomal function, and stress response pathways.

What expression systems are optimal for producing functional recombinant Na(+)/H(+) antiporter subunit G1?

For optimal expression of functional recombinant Na(+)/H(+) antiporter subunit G1, E. coli-based expression systems have proven effective. The pET22b(+) vector system with E. coli BL21(DE3) as the host strain has successfully expressed functional g1-nhaC from alkaliphilic Bacillus sp. G1 . This system includes key elements for successful membrane protein expression: a strong inducible promoter, appropriate signal sequences, and a host strain optimized for protein production. When expressing membrane proteins like antiporters, careful optimization of induction conditions is necessary to balance protein yield with potential toxicity. Growth media composition significantly impacts expression outcomes - modified L medium allowing adjustment of both NaCl concentration (0.2-2.0M) and pH (8.0-10.0) helps verify functional expression . For purification purposes, adding epitope tags (like HA-tag) to the C-terminus has been shown not to affect antiporter function, facilitating downstream purification and detection .

How can researchers effectively measure Na(+)/H(+) antiporter activity in experimental systems?

Effective measurement of Na(+)/H(+) antiporter activity can be accomplished through several complementary approaches. Growth-based functional assays provide a straightforward assessment of antiporter activity - comparing growth of recombinant versus control cells in media with varying NaCl concentrations (0.2-2.0M) and pH values (8.0-10.0) . For more direct biochemical measurements, researchers can monitor intracellular pH changes using fluorescent probes while manipulating extracellular sodium concentrations. To verify that functional defects in mutants result from altered transport rather than expression issues, researchers should employ Western blotting and immunofluorescence microscopy to confirm proper protein expression and localization . Fluorescent dyes like FM4-64 can reveal trafficking defects in cells with compromised antiporter function . For comprehensive characterization, combining growth phenotypes, direct transport measurements, and localization studies provides the most robust assessment of antiporter functionality.

What mutagenesis approaches best identify functional domains in Na(+)/H(+) antiporter subunit G1?

Site-directed mutagenesis provides the most targeted approach for identifying functional domains in Na(+)/H(+) antiporter subunit G1. Based on studies with related transporters, focusing on conserved acidic residues (aspartate and glutamate) in predicted transmembrane domains yields valuable insights into structure-function relationships. In Nhx1p studies, mutation of specific residues (D201N, E225Q, and D230N) completely abolished antiporter function while maintaining normal protein expression and localization . This approach allows precise mapping of residues involved in ion binding and transport. When designing mutagenesis experiments, researchers should:

  • Target conserved residues identified through sequence alignment

  • Focus on charged residues likely involved in ion coordination

  • Create conservative substitutions that maintain protein structure

  • Verify mutant protein expression and localization

  • Test function through complementation of antiporter-deficient strains

This systematic approach helps distinguish residues critical for transport function from those important for protein folding or stability.

What experimental controls are essential when characterizing recombinant Na(+)/H(+) antiporter function?

Essential experimental controls for characterizing recombinant Na(+)/H(+) antiporter function include:

  • Empty vector controls: Cells transformed with expression vector lacking the antiporter gene must be tested under identical conditions to distinguish antiporter-specific effects from vector-related artifacts .

  • Expression verification: Western blotting or other protein detection methods should confirm that the recombinant protein is expressed at the expected molecular weight (e.g., 57.8 kDa for g1-NhaC) .

  • Localization controls: Immunofluorescence or cell fractionation should verify proper membrane localization of the expressed antiporter .

  • Functional mutant comparisons: Including known non-functional mutants (like D201N, E225Q, D230N equivalents) alongside potentially functional variants helps establish the dynamic range of your assay system .

  • Host strain validation: Using genetically defined antiporter-deficient strains (like E. coli nhaA/nhaB mutants or equivalent yeast strains) ensures that measured activity stems from the recombinant protein rather than endogenous transporters .

These controls collectively ensure that observed phenotypes genuinely reflect the properties of the recombinant Na(+)/H(+) antiporter under investigation.

How do Na(+)/H(+) antiporters contribute to bacterial adaptation to extreme environments?

Na(+)/H(+) antiporters play crucial roles in bacterial adaptation to extreme environments, particularly alkaline and high-salt conditions. The g1-NhaC antiporter from alkaliphilic Bacillus sp. G1 demonstrates remarkable functionality at high pH values, contributing to both Na(+) extrusion and pH homeostasis . At pH 8.0-9.0, it allows growth in NaCl concentrations as high as 1.75M, while at pH 10, it functions effectively even at lower sodium concentrations (0.2M) . This adaptability enables alkaliphilic bacteria to colonize environments inhospitable to most organisms. The sophisticated pH-dependent regulation of these transporters represents an evolutionary adaptation to challenging ecological niches. By maintaining appropriate intracellular pH and ion concentrations despite extreme external conditions, these antiporters serve as frontline defense mechanisms against environmental stress. Understanding these adaptations provides insights into the molecular basis of extremophile biology and potential applications in biotechnology for creating stress-resistant microbial platforms.

What insights do recombinant Na(+)/H(+) antiporter studies provide for understanding human ion transport disorders?

Recombinant Na(+)/H(+) antiporter studies provide valuable insights for understanding human ion transport disorders through several mechanisms. Research techniques developed for bacterial and yeast antiporters, such as gene cloning methods and selective techniques based on acid killing that identify cells expressing antiport activity, have been successfully applied to isolate human Na(+)/H(+) antiporter genes . These approaches enabled researchers to express the human Na(+)/H(+) antiporter gene in mouse cells lacking endogenous antiporter activity . The fundamental mechanisms of ion selectivity, pH sensitivity, and transport regulation are largely conserved between microbial and human antiporters. Mutations affecting key acidic residues in bacterial transporters inform our understanding of how similar mutations might impact human transporters involved in diseases like hypertension, neurological disorders, and cancer where ion homeostasis is disrupted. Additionally, the well-characterized bacterial systems serve as platforms for screening potential therapeutic compounds targeting human ion transport proteins.

How might synthetic biology approaches enhance Na(+)/H(+) antiporter functionality for biotechnological applications?

Synthetic biology approaches offer promising avenues for enhancing Na(+)/H(+) antiporter functionality for biotechnological applications. Researchers could employ directed evolution or rational design to create antiporter variants with improved properties such as:

  • Enhanced salt tolerance: Engineering antiporters with higher Na+ extrusion capacity could create microbial platforms for bioproduction in high-salt environments or bioremediation of saline-contaminated sites.

  • Modified pH sensitivity: Adjusting the pH response profile of antiporters could extend functionality across broader pH ranges, particularly valuable for industrial processes requiring extreme pH conditions.

  • Altered ion selectivity: Engineering antiporters to transport specific ions beyond Na+ could create novel bioremediation tools for environmental cleanup of various metal ions.

  • Temperature stability: Increasing thermostability of these transporters could expand their utility in industrial bioprocesses occurring at elevated temperatures.

These enhanced antiporters could be integrated into various host organisms, from industrial microbes to crop plants, potentially enabling growth and productivity under previously prohibitive environmental conditions.

What computational approaches can predict structure-function relationships in Na(+)/H(+) antiporter variants?

Modern computational approaches offer powerful tools for predicting structure-function relationships in Na(+)/H(+) antiporter variants. Given the challenges of membrane protein crystallography, homology modeling based on related transporters with known structures provides initial structural insights. Molecular dynamics simulations can model ion permeation pathways, identifying critical residues involved in ion coordination and transport. Sequence-based approaches including multiple sequence alignment across diverse species help identify conserved residues likely essential for function, as demonstrated by the critical role of certain acidic residues (D201, E225, D230) in related transporters . Machine learning algorithms trained on existing transporter data could predict the functional consequences of specific mutations. Quantum mechanical calculations can model the energetics of ion binding and release during the transport cycle. Together, these computational approaches guide experimental design by generating testable hypotheses about which residues control ion selectivity, pH sensitivity, and transport kinetics in Na(+)/H(+) antiporters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.