Recombinant Nandina domestica ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant atpI is a full-length protein (1-247 amino acids) derived from Nandina domestica (Heavenly bamboo), expressed in E. coli or yeast systems with an N-terminal His-tag for purification . Key features include:

PropertyDetails
UniProt IDQ09FX3
Gene NameatpI
SynonymsATP synthase F0 sector subunit a, F-ATPase subunit IV
Source OrganismNandina domestica (Heavenly bamboo)
Expression SystemE. coli (common), yeast (alternative)
Purity>90% (SDS-PAGE)

Amino Acid Sequence

The protein sequence (247 residues) begins with MNVLPCSINTLKGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVMAILLGSATIVVRN... and terminates with ...IQALIFATLAAAYIGESMEGHH . This sequence aligns with the chloroplast-localized ATP synthase subunit a, essential for proton channeling in ATP synthesis .

Physical Properties

  • Molecular Weight: ~27 kDa (calculated based on sequence length) .

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) .

  • Reconstitution: Requires dilution in sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for stability .

Functional Insights

ATP synthase subunit a forms part of the F0 sector of ATP synthase, facilitating proton translocation across chloroplast membranes to drive ATP production . While direct enzymatic activity data for the recombinant protein is not explicitly reported, its structural homology to other plant ATP synthase subunits suggests conserved roles in photosynthesis .

Applications in Research

Recombinant atpI is primarily utilized for:

  • Structural studies: Investigating chloroplast ATP synthase assembly and proton transport mechanisms .

  • Enzyme activity assays: Reconstitution with other ATP synthase subunits to study kinetic properties .

  • Plant biochemistry: Serving as a reference protein for comparative studies in photosynthetic organisms .

Comparative Analysis of Expression Systems

Data from multiple vendors highlight variations in production platforms:

ParameterE. coli Yeast
Purity>90%>85%
TagHis-tagHis-tag (variable)
Storage-20°C/-80°C (lyophilized)-20°C/-80°C (lyophilized)
ReconstitutionGlycerol recommendedGlycerol recommended

Research Gaps and Future Directions

  • Activity profiling: No kinetic data (e.g., Km/Vmax) or proton transport efficiency metrics are publicly available .

  • Post-translational modifications: Unreported in current studies, despite their potential impact on function .

  • In vivo applications: Limited evidence for use in plant transformation or chloroplast engineering .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Nandina domestica (Heavenly bamboo)
Target Names
atpI
Target Protein Sequence
MNVLPCSINTLKGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVMAILLGSATIVVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does chloroplastic ATP synthase differ from mitochondrial ATP synthase?

Chloroplastic ATP synthases like those found in Nandina domestica share fundamental mechanistic features with mitochondrial and bacterial ATP synthases, but exhibit distinct structural differences:

  • Location and Environment: Chloroplastic ATP synthase operates in the thylakoid membrane of chloroplasts, whereas mitochondrial ATP synthase functions in the inner mitochondrial membrane .

  • Subunit Composition: While both use a rotary mechanism, chloroplastic ATP synthase has some unique subunits and structural adaptations specific to the chloroplast environment.

  • Regulation: Regulatory mechanisms differ between chloroplastic and mitochondrial ATP synthases. Chloroplastic ATP synthase regulation is often linked to photosynthetic activity and light-dependent processes.

  • Direction of Rotation: During active photosynthesis, chloroplastic ATP synthase typically operates in synthesis mode, utilizing the proton gradient generated by light reactions, while mitochondrial ATP synthase can switch between synthesis and hydrolysis modes depending on cellular conditions .

For research applications, understanding these differences is crucial when designing experiments or interpreting results from studies using recombinant chloroplastic ATP synthase components.

What expression systems are optimal for producing recombinant Nandina domestica ATP synthase subunit a?

Researchers have successfully employed multiple expression systems for producing recombinant Nandina domestica ATP synthase subunits, each with specific advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliCost-effective, rapid growth, high yieldsMay require optimization for membrane proteins, potential inclusion body formationUsed for atpH subunit with His-tag
Mammalian cellsBetter for complex folding, post-translational modificationsMore expensive, slower growthUsed for atpI production with >85% purity

Methodology for E. coli expression:

  • Clone the atpI gene into an appropriate expression vector with a His-tag or other purification tag

  • Transform into an E. coli expression strain (BL21(DE3) or derivatives)

  • Induce expression with IPTG at optimal temperature (typically 16-25°C for membrane proteins)

  • Harvest cells and extract protein using appropriate detergents

  • Purify using affinity chromatography based on the fusion tag

For mammalian cell expression, specialized vectors and transfection protocols are required, but may yield protein with more native-like properties for certain applications .

What are the recommended storage and reconstitution protocols for maintaining recombinant atpI activity?

Proper storage and reconstitution are critical for maintaining the structural integrity and functional activity of recombinant ATP synthase subunits:

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C for up to 12 months

  • For liquid formulations, storage at -20°C/-80°C provides a shelf life of approximately 6 months

  • Avoid repeated freeze-thaw cycles, which can significantly reduce protein activity

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is typically recommended)

  • Prepare small aliquots for long-term storage at -20°C/-80°C

The storage buffer typically consists of a Tris-based buffer with 50% glycerol, optimized for protein stability . For functional studies, researchers should validate activity immediately after reconstitution and periodically during storage to ensure experimental reliability.

How can researchers study the catalytic mechanism of ATP synthase using recombinant subunits?

Investigating the catalytic mechanism of ATP synthase requires sophisticated experimental approaches that can incorporate recombinant subunits:

Site-directed mutagenesis approach:

  • Identify key residues involved in catalysis from crystal structures and sequence alignments

  • Generate point mutations in the recombinant atpI construct

  • Express and purify mutant proteins using the protocols described in section 2.1

  • Reconstitute with other ATP synthase subunits

  • Measure effects on:

    • ATP synthesis/hydrolysis rates

    • Proton translocation

    • Binding of substrates and inhibitors

Research has identified several critical residues in ATP synthase that participate in phosphate binding, including αPhe-291, αSer-347, αGly-351, αArg-376, βLys-155, βArg-182, βAsn-243, and βArg-246 . These residues play crucial roles in the "binding change mechanism" proposed by Boyer, where the three catalytic sites undergo sequential conformational changes during ATP synthesis .

The rotary mechanism of ATP synthase involves the sequential binding of ADP and Pi, synthesis of ATP, and release of ATP. During active ATP synthesis, the central rotor turns approximately 150 times per second . Understanding how mutations in atpI affect this rotational mechanism provides valuable insights into the fundamental bioenergetic processes of chloroplasts.

What is the role of ATP synthase subunit a in proton translocation and how can it be experimentally investigated?

Subunit a of ATP synthase plays a crucial role in proton translocation across the membrane, which drives the rotary mechanism essential for ATP synthesis:

Key functions of subunit a:

  • Forms part of the proton channel in the membrane-embedded F₀ sector

  • Contains residues that facilitate proton movement from one side of the membrane to the other

  • Interacts with the c-ring to couple proton movement to rotational motion

Experimental methods to investigate proton translocation:

  • Reconstitution into liposomes or nanodiscs:

    • Purify recombinant atpI and other essential subunits

    • Reconstitute into lipid bilayers

    • Measure proton pumping using pH-sensitive dyes or electrodes

  • Site-directed mutagenesis:

    • Target conserved residues potentially involved in proton pathway

    • Measure effects on proton translocation and ATP synthesis

    • Compare with wild-type activity under identical conditions

  • Inhibitor studies:

    • Test known ATP synthase inhibitors like polyphenols (e.g., (+)-Epicatechin)

    • Determine binding sites and mechanisms of inhibition

    • Analyze structure-activity relationships

Research has shown that loss of proton motive force can induce ATP hydrolysis by ATP synthase, which is normally inhibited by the mitochondrial protein ATPase inhibitor (ATPIF1) . The inhibition of this reverse activity by compounds like (+)-Epicatechin can restore ATP content in cells with respiratory chain deficiencies, suggesting therapeutic potential for certain mitochondrial disorders .

How do natural polyphenols interact with ATP synthase and what are their potential research applications?

Natural polyphenols represent an important class of ATP synthase inhibitors with significant research applications:

Mechanism of polyphenol inhibition:

  • Polyphenols like (+)-Epicatechin can selectively inhibit ATP hydrolysis activity of ATP synthase

  • They bind to the enzyme at the interface of α/β subunits

  • This binding prevents the association of regulatory proteins like ATPIF1

  • Importantly, these compounds can inhibit ATP hydrolysis without affecting ATP synthesis

Research applications:

  • Structural studies: Using polyphenols as molecular probes to understand binding sites and conformational changes in ATP synthase

  • Bioenergetic investigations: Exploring the differential effects on synthesis versus hydrolysis activities

  • Therapeutic development: As models for designing selective inhibitors for treating mitochondrial disorders

Recent research has demonstrated that inhibition of ATP synthase hydrolytic activity by (+)-Epicatechin was sufficient to restore ATP content in cells with Complex-III deficiency without restoring respiratory function . In a mouse model of Duchenne Muscular Dystrophy, inhibition of ATP synthase hydrolysis improved muscle force without increasing mitochondrial content .

These findings suggest that selective inhibition of ATP synthase reverse activity represents a promising research direction for addressing energy deficits in mitochondrial disorders.

What methodologies are available for studying the interaction between recombinant atpI and potential inhibitors?

Researchers have several sophisticated methodologies available for investigating interactions between recombinant ATP synthase subunits and potential inhibitors:

Biochemical binding assays:

  • Surface plasmon resonance (SPR) to measure real-time binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Fluorescence anisotropy for solution-phase binding studies

Functional assays:

  • ATP synthesis measurements using luciferin/luciferase assays

  • ATP hydrolysis assays measuring phosphate release

  • Proton pumping assays using pH-sensitive fluorescent dyes

Structural approaches:

  • X-ray crystallography of protein-inhibitor complexes

  • Cryo-electron microscopy for larger assemblies

  • Nuclear magnetic resonance (NMR) for mapping binding interfaces

Computational methods:

  • Molecular docking to predict binding modes

  • Molecular dynamics simulations to understand binding stability and conformational changes

  • Virtual screening for identifying novel inhibitor candidates

When investigating potential inhibitors, it's important to distinguish between compounds that affect ATP synthesis versus ATP hydrolysis. Research has identified distinct binding sites for different classes of inhibitors, with polyphenols binding at the interface of α/β subunits . These studies also highlight the importance of specific residues in the catalytic sites for binding phosphate analogs, including αPhe-291, αSer-347, αGly-351, αArg-376, βLys-155, βArg-182, βAsn-243, and βArg-246 .

How does Nandina domestica ATP synthase subunit a compare structurally and functionally to homologs from other species?

Understanding the evolutionary and functional relationships between ATP synthase subunits across species provides valuable insights for research:

Comparative features across species:

SpeciesUnique FeaturesConserved ElementsResearch Relevance
Nandina domestica (Plant)Chloroplast-specific adaptationsCore catalytic machineryPhotosynthesis research
E. coli (Bacteria)Simpler subunit compositionF₀-F₁ basic structureAntibiotic development targets
Human (Mitochondria)Regulatory mechanisms for tissue-specific needsRotary mechanism, key catalytic residuesDisease modeling, therapeutic targets

The bacterial and chloroplast ATP synthases share many common features with mitochondrial enzymes, but significant differences exist in structure and regulation . These differences offer opportunities for developing selective inhibitors that could target bacterial ATP synthases without affecting human mitochondrial function, potentially leading to new antibiotics against multiple drug-resistant organisms .

ATP synthase is already an established clinical target for treating tuberculosis, highlighting its importance in antimicrobial research .

What are the most effective reconstitution methods for functional studies of recombinant ATP synthase components?

For functional studies of ATP synthase, proper reconstitution of individual subunits into functional complexes is critical:

Reconstitution approaches:

  • Liposome reconstitution:

    • Prepare liposomes using lipids that mimic the native membrane environment

    • Incorporate purified recombinant subunits using detergent-mediated methods

    • Remove detergent through dialysis or bio-beads

    • Verify orientation and integration using protease protection assays

  • Nanodiscs assembly:

    • Combine recombinant membrane scaffold proteins with appropriate lipids

    • Add purified ATP synthase subunits

    • Form disc-shaped bilayers that stabilize membrane proteins

    • Offers advantage of defined size and composition

  • Co-expression systems:

    • Co-express multiple subunits in the same cell system

    • Allow natural assembly of complexes

    • Purify intact complexes rather than individual subunits

    • May yield more stable and functionally relevant assemblies

Functional verification methods:

  • ATP synthesis assays using acid-base transitions

  • ATP hydrolysis measurements using phosphate release assays

  • Proton pumping using pH-sensitive fluorescent probes

  • Rotational measurements using single-molecule techniques

Research on mitochondrial ATP synthase has shown that the enzyme rotates at approximately 150 revolutions per second during ATP synthesis . This high-speed molecular motor requires precise assembly of all components, making careful reconstitution essential for mechanistic studies.

What are common challenges in working with recombinant ATP synthase subunits and how can researchers address them?

Working with membrane proteins like ATP synthase subunits presents specific challenges that researchers should anticipate:

Common challenges and solutions:

ChallengePotential CausesSolutions
Low expression yieldToxicity to host cells, protein misfoldingUse specialized expression strains, lower induction temperature, fusion tags
Protein aggregationImproper folding, detergent mismatchScreen different detergents, add stabilizing agents, optimize buffer conditions
Loss of activity during purificationDetergent effects, cofactor lossInclude essential lipids, gentle purification methods, maintain reducing environment
Inconsistent reconstitutionVariability in lipid composition, incomplete incorporationStandardize lipid preparations, verify incorporation by analytical methods

Quality control measures:

  • SDS-PAGE analysis to verify purity (>85% for typical applications, >90% for structural studies)

  • Mass spectrometry to confirm protein identity and detect modifications

  • Circular dichroism to assess secondary structure

  • Activity assays to verify functional integrity

For recombinant Nandina domestica ATP synthase subunits, storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to maintain stability . Working aliquots should be maintained at 4°C for no more than one week to ensure reproducible results in functional assays .

How can researchers verify the structural integrity and proper folding of recombinant atpI?

Ensuring proper folding and structural integrity of recombinant ATP synthase subunits is essential for meaningful experimental results:

Verification methods:

  • Spectroscopic techniques:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to monitor tertiary structure through intrinsic tryptophan fluorescence

    • Fourier-transform infrared spectroscopy (FTIR) for membrane proteins in lipid environments

  • Hydrodynamic methods:

    • Size-exclusion chromatography to verify monodispersity

    • Analytical ultracentrifugation to determine oligomeric state

    • Dynamic light scattering to assess aggregation state

  • Functional verification:

    • Binding assays with known ligands or antibodies

    • Activity measurements when incorporated into functional complexes

    • Interaction studies with partner proteins or subunits

  • Thermal stability assays:

    • Differential scanning calorimetry

    • Thermal shift assays

    • Temperature-dependent activity measurements

For membrane proteins like atpI, proper solubilization and stabilization in detergent micelles or lipid environments are crucial. Researchers should consider using mild detergents and native-like lipid compositions to maintain the structural integrity of the protein. The choice of purification tags (such as His-tags) should be evaluated for their potential impact on structure and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.