Recombinant Nandina domestica Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

The cemA protein is encoded by the cemA gene in Nandina domestica and is localized to the chloroplast envelope membrane. Its primary function relates to chloroplast membrane integrity, though specific mechanistic roles remain under investigation.

ParameterSpecification
UniProt IDQ09FU9
Expression RegionFull-length protein (1–229 amino acids)
Expression HostLikely E. coli (inferred from similar recombinant plant proteins )
TaggingTag type determined during production (e.g., His-tag, GST-tag)
Storage BufferTris-based buffer with 50% glycerol

Production and Handling

Recombinant cemA is produced in controlled laboratory settings, with emphasis on purity and stability:

ParameterDetail
Purity≥90% as determined by SDS-PAGE (inferred from related proteins )
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles
ReconstitutionTris/PBS-based buffer with 6% trehalose (pH 8.0)
Shelf LifeLong-term storage at -20°C/-80°C; aliquot for multiple use

Availability and Challenges

The recombinant cemA protein is currently not available for commercial purchase , suggesting it may be a discontinued or highly specialized product. Researchers may need to:

  1. Custom Synthesize: Collaborate with contract research organizations to produce the protein.

  2. Alternative Species: Explore analogous proteins from model organisms (e.g., Oryza sativa cemA ).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Nandina domestica (Heavenly bamboo)
Target Names
cemA
Target Protein Sequence
MTKKKAFTPLPYLASIVFLPWWISFSFNKSLESWVIHWWNTSQPEAFLNDIQEKNVLEKF IELEELFLLDEMIKEYPKTHIQKFRIGIHKETIQLVKMHNEGHIHTFLQFSTNIISFAIL SGYSILGNEELVVLNSWIREFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIDFVYKD FGFSHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast envelope membrane protein (cemA) in Nandina domestica?

The chloroplast envelope membrane protein (cemA) is a 229-amino acid protein localized in the chloroplast envelope membranes of Nandina domestica (Heavenly bamboo). Based on the full amino acid sequence (MTKKKAFTPLPYLASIVFLPWWISFSFNKSLESWVIHWWNTSQPEAFLNDIQEKNVLEKFIELEELFLLDEMIKEYPKTHIQKFRIGIHKETIQLVKMHNEGHIHTFLQFSTNIISFAILSGYSILGNEELVVLNSWIREFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIDFVYKDFGFSHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND), it contains hydrophobic regions consistent with a membrane-spanning protein . The cemA protein belongs to the broader category of chloroplast envelope proteins that are critical for maintaining chloroplast function and mediating interactions between the chloroplast and the rest of the cell .

What methods are most effective for isolating chloroplast envelope membranes from Nandina domestica?

Isolation of chloroplast envelope membranes from Nandina domestica requires a multi-step approach to ensure high purity and intact functional properties. Based on established protocols for chloroplast envelope isolation, an effective methodology would include:

  • Tissue preparation: Young leaves should be harvested and homogenized in an isolation buffer containing osmotic stabilizers (typically 0.33M sorbitol) and protease inhibitors.

  • Chloroplast isolation: The homogenate should be filtered and subjected to differential centrifugation, followed by purification on Percoll gradients to obtain intact chloroplasts.

  • Envelope membrane separation: Purified chloroplasts are subjected to osmotic shock to release envelope membranes, which are then separated by sucrose gradient ultracentrifugation.

  • Membrane subfraction enrichment: Different extraction methods (chloroform/methanol extraction, alkaline or saline treatments) should be employed to retrieve proteins with varying hydrophobicity .

Special consideration must be given to Nandina's woody nature and high content of secondary metabolites, which may interfere with isolation procedures. The inclusion of polyvinylpyrrolidone (PVP) in isolation buffers is recommended to adsorb phenolic compounds that could otherwise bind to and denature proteins.

How can researchers verify the purity and identity of isolated cemA protein?

Verification of cemA purity and identity requires a combination of analytical techniques:

  • SDS-PAGE analysis: Purified protein should show a band corresponding to the expected molecular weight of cemA (~25-30 kDa depending on post-translational modifications).

  • Western blot analysis: Using antibodies specific to cemA or to engineered tags (if using recombinant protein).

  • Mass spectrometry: Liquid chromatography tandem mass spectrometry (LC-MS/MS) analysis can confirm protein identity based on peptide fragments matching the known cemA sequence .

  • Protein sequence verification: N-terminal sequencing can verify the start of the mature protein and identify potential N-α-acetylation, which has been observed in other chloroplast envelope proteins .

  • Functional assays: Depending on the hypothesized function of cemA, activity assays may provide further verification of a correctly folded, functional protein.

What expression systems are suitable for producing recombinant cemA protein?

Selection of an appropriate expression system depends on research objectives and required protein characteristics:

  • Bacterial systems (E. coli):

    • Advantages: High yield, simplicity, cost-effectiveness

    • Limitations: May not properly fold membrane proteins or provide post-translational modifications

    • Optimization: Use of specialized strains (C41/C43) designed for membrane protein expression

  • Yeast systems (P. pastoris, S. cerevisiae):

    • Advantages: Better for membrane protein folding, some post-translational modifications

    • Limitations: Lower yield than bacterial systems

    • Applications: Functional studies requiring proper folding

  • Insect cell systems:

    • Advantages: Complex eukaryotic folding machinery, post-translational modifications

    • Limitations: Higher cost, technical complexity

    • Applications: Structural studies requiring native-like protein

  • Plant-based expression:

    • Advantages: Native environment for chloroplast proteins

    • Methods: Transient expression in Nicotiana benthamiana or stable transformation

    • Applications: In vivo functional studies, native interactions

For cemA, which is a chloroplast membrane protein, initial characterization might employ bacterial systems with subsequent validation in plant-based systems to ensure physiological relevance .

What is known about the structural features of cemA based on sequence analysis?

Analysis of the cemA amino acid sequence reveals several important structural features:

  • Transmembrane domains: Hydrophobicity analysis suggests multiple membrane-spanning regions, consistent with integral membrane protein architecture.

  • N-terminal region: The sequence begins with "MTKKKAF", containing positively charged residues that may interact with membrane phospholipids or function in targeting.

  • Hydrophilic loops: Several hydrophilic segments likely form loops extending into aqueous environments on either side of the membrane.

  • Conserved motifs: Comparison with other chloroplast envelope proteins may reveal conserved functional domains involved in transport or protein-protein interactions.

  • Potential modification sites: Analysis for phosphorylation, glycosylation, or other modification sites provides insights into regulatory mechanisms.

The full sequence analysis indicates cemA is likely anchored in the chloroplast envelope through multiple transmembrane segments, with hydrophilic domains extending into stromal and intermembrane spaces that may mediate specific functions .

How does cemA expression respond to environmental stresses, particularly cold acclimation?

Research on chloroplast envelope proteins suggests that cemA expression and abundance may change significantly under stress conditions. Studies in Arabidopsis have demonstrated that chloroplast envelope proteins show differential regulation during cold acclimation, with some transporters (like ATP/ADP antiporter NTT2) increasing in abundance while others (like maltose exporter MEX1) decrease . To characterize cemA responses to environmental stresses:

  • Transcriptional regulation: Quantitative RT-PCR analysis of cemA mRNA levels under various stress conditions (cold, drought, salinity, high light) would reveal transcriptional regulation.

  • Protein abundance changes: Western blot analysis of chloroplast envelope fractions from stressed plants would quantify changes in cemA protein levels.

  • Post-translational modifications: Proteomic analysis using mass spectrometry could identify stress-induced modifications that might alter cemA function.

  • Comparative analysis: Comparison of cemA regulation with known stress-responsive chloroplast envelope proteins would provide context for interpreting results.

Given Nandina domestica's known cold hardiness, cemA may play a role in cold acclimation mechanisms, potentially facilitating metabolite transport essential for freezing tolerance .

What role might cemA play in Nandina domestica's production of cyanogenic compounds?

Nandina domestica contains cyanogenic glycosides that can release hydrogen cyanide when plant tissues are damaged . These compounds make berries and other plant parts toxic to birds, pets, and humans when ingested in sufficient quantities . The cemA protein might be involved in this metabolism in several possible ways:

  • Precursor transport: cemA could transport precursors for cyanogenic glycoside synthesis between cellular compartments.

  • Sequestration mechanism: It might participate in sequestering toxic intermediates during biosynthesis.

  • Stress-induced regulation: cemA could regulate metabolic flux toward defense compounds during stress.

To investigate these possibilities, researchers should:

  • Compare cemA expression levels with cyanogenic glycoside content across different tissues and developmental stages.

  • Analyze changes in both cemA expression and cyanogenic compound levels under stress conditions.

  • Generate cemA knockdown/knockout lines to observe effects on cyanogenic glycoside accumulation.

  • Perform transport assays with purified cemA reconstituted in liposomes to test substrate specificity for relevant metabolites.

Understanding cemA's potential role in cyanogenic compound metabolism would provide insights into both the plant's defense mechanisms and the molecular basis for Nandina toxicity .

How does the protein-protein interaction network of cemA change during plant development and stress responses?

Chloroplast envelope proteins function within complex networks of protein-protein interactions that may be dynamically regulated during development and stress responses. To characterize cemA's interaction network:

  • Co-immunoprecipitation coupled with mass spectrometry (Co-IP-MS) can identify proteins that physically interact with cemA under different conditions.

  • Split-ubiquitin or split-GFP assays, which are suitable for membrane proteins, can verify direct interactions between cemA and candidate partners.

  • Bimolecular fluorescence complementation (BiFC) in plant protoplasts can confirm interactions in vivo and reveal their subcellular localization.

  • Dynamic changes in the interaction network can be tracked by performing these analyses across developmental stages and stress conditions.

Potential interaction partners may include:

  • Other chloroplast envelope transporters for coordinated metabolite flux

  • Components of the protein import machinery

  • Enzymes involved in lipid metabolism

  • Signaling proteins that mediate stress responses

Changes in these interactions during cold acclimation would be particularly interesting, given the differential regulation of chloroplast envelope proteins during this process .

What are the structure-function relationships in cemA and how can they be experimentally determined?

Understanding structure-function relationships in cemA requires a systematic approach:

  • Computational structure prediction:

    • Homology modeling based on related proteins with known structures

    • Ab initio modeling of transmembrane domains

    • Molecular dynamics simulations to predict conformational changes

  • Experimental structure determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy of purified protein or envelope membrane fragments

    • Solid-state NMR of reconstituted protein

  • Functional mapping through mutagenesis:

    • Alanine scanning of transmembrane domains

    • Site-directed mutagenesis of conserved residues

    • Domain swapping with related proteins

    • Truncation analysis to identify minimal functional units

  • Structure-guided functional assays:

    • Transport assays with wild-type and mutant proteins

    • Binding studies with potential substrates or interaction partners

    • In vivo complementation assays in model systems

The amino acid sequence provided in search result should be analyzed to identify conserved domains and residues likely to be functionally important before designing mutagenesis experiments.

How can proteomics approaches be optimized for studying cemA and other low-abundance chloroplast envelope proteins?

Chloroplast envelope proteins like cemA often present challenges for proteomic analysis due to their relatively low abundance and hydrophobic nature. Optimized approaches include:

  • Enhanced envelope membrane purification:

    • Multiple purification steps to achieve high purity

    • Verification of fraction purity using marker proteins

    • Careful separation of inner and outer envelope membranes

  • Specialized protein extraction methods:

    • Comparison of multiple extraction protocols (chloroform/methanol, alkaline, saline)

    • Optimization of detergent types and concentrations

    • Sequential extraction to capture proteins of different hydrophobicity

  • Mass spectrometry adaptations:

    • Enrichment of membrane protein fractions

    • Use of alternative proteases beyond trypsin for better coverage

    • Application of data-independent acquisition methods

    • Enhanced peptide separation through multidimensional chromatography

  • Data analysis strategies:

    • Specialized algorithms for membrane protein identification

    • Statistical methods for quantification of low-abundance proteins

    • Multivariable logistic regression for accurate localization prediction

These approaches have successfully identified more than 100 chloroplast envelope proteins in Arabidopsis, with approximately 80% confirmed to be genuine envelope proteins .

What are effective strategies for generating cemA knockout or knockdown lines in Nandina domestica?

Generating cemA-deficient lines in Nandina domestica presents challenges due to its woody perennial nature and limited genetic resources. Strategic approaches include:

  • CRISPR/Cas9-mediated gene editing:

    • Design of guide RNAs targeting conserved regions of cemA

    • Optimization of transformation protocols for Nandina tissue

    • Screening for mutations using targeted sequencing

    • Regeneration of plants from edited cells

  • RNA interference (RNAi):

    • Construction of hairpin RNA constructs targeting cemA

    • Stable transformation via Agrobacterium

    • Selection of lines with varying levels of knockdown for dose-response studies

    • Verification of specificity through transcriptome analysis

  • Virus-induced gene silencing (VIGS):

    • Development of viral vectors carrying cemA fragments

    • Infection of established plants for transient knockdown

    • Analysis during the silencing period before recovery

  • Heterologous complementation:

    • Expression of Nandina cemA in model plants with mutations in homologous genes

    • Analysis of functional complementation

    • Expression of mutant versions to identify critical residues

Given the potential importance of cemA for chloroplast function, complete knockout might be lethal, necessitating inducible or tissue-specific approaches to study its function .

How can researchers design transport assays to test cemA function in metabolite movement across chloroplast membranes?

If cemA functions as a transporter, several approaches can assess its substrate specificity and kinetics:

  • Liposome reconstitution assays:

    • Purification of recombinant cemA protein

    • Reconstitution into proteoliposomes

    • Loading liposomes with potential substrates

    • Measurement of substrate transport using radioisotopes or fluorescent analogs

    • Determination of transport kinetics and inhibitor sensitivity

  • Chloroplast uptake studies:

    • Isolation of intact chloroplasts from wild-type and cemA-deficient plants

    • Incubation with labeled substrates

    • Measurement of substrate accumulation over time

    • Analysis of competition with unlabeled compounds

  • Electrophysiological approaches:

    • Patch-clamp analysis of envelope membranes

    • Planar lipid bilayer recordings with purified cemA

    • Characterization of transport-associated currents

  • In vivo metabolite tracking:

    • Stable isotope labeling of precursors

    • Comparison of metabolite distribution in wild-type versus cemA-deficient plants

    • Analysis of metabolic flux using mass spectrometry

The design of these assays should consider that chloroplast envelope proteins may function in the transport of various substrates including ions, metabolites, lipids, or proteins .

What analytical techniques can effectively characterize post-translational modifications of cemA?

Post-translational modifications (PTMs) can significantly impact cemA function, localization, and interactions. Comprehensive characterization requires:

  • Mass spectrometry-based approaches:

    • Enrichment strategies for specific modifications (phosphopeptides, glycopeptides)

    • High-resolution MS/MS for precise mass determination

    • Electron transfer dissociation (ETD) for labile modifications

    • Parallel reaction monitoring (PRM) for targeted quantification of modified peptides

  • Site-specific analysis:

    • Generation of antibodies against specific modified forms

    • Mutagenesis of potential modification sites

    • Functional comparison of wild-type and modification-site mutants

  • Dynamic PTM profiling:

    • Analysis of modification changes during development

    • Comparison of PTM patterns under different stress conditions

    • Correlation of modifications with protein activity or localization

  • Integrative analysis:

    • Computational prediction of modification enzymes

    • Co-expression analysis of cemA with modification enzymes

    • Identification of motifs surrounding modification sites

Search result notes that some chloroplast envelope proteins are N-α-acetylated, suggesting this might be an important modification for cemA that could affect its stability or interactions.

What statistical approaches are most appropriate for analyzing differential expression of cemA under various experimental conditions?

Robust statistical analysis of cemA expression data requires:

  • For transcriptomic data:

    • Normalization methods appropriate for the platform (microarray, RNA-Seq)

    • Linear models with empirical Bayes methods (limma) for differential expression

    • Multiple testing correction (Benjamini-Hochberg) to control false discovery rate

    • Power analysis to determine appropriate sample sizes

  • For proteomic quantification:

    • Normalization strategies specific to the quantification method used

    • Linear mixed-effects models for complex experimental designs

    • Appropriate imputation strategies for missing values

    • Technical and biological variation separation

  • For time-course experiments:

    • Time-series analysis methods (e.g., EDGE, maSigPro)

    • Change-point detection algorithms

    • Functional data analysis approaches

  • For multi-omics integration:

    • Correlation-based methods linking transcript and protein changes

    • Pathway enrichment analysis incorporating multiple data types

    • Network analysis to identify coordinated regulatory responses

The approach used in search result , which employed multivariable logistic regression to model the probabilities for envelope localization, illustrates the need for sophisticated statistical methods when analyzing complex data related to chloroplast envelope proteins.

How can researchers distinguish between direct effects of cemA manipulation and secondary consequences in functional studies?

Distinguishing primary from secondary effects in cemA functional studies requires:

  • Temporal resolution:

    • Early time-point sampling after cemA manipulation

    • Time-course analysis to track cascade of changes

    • Use of inducible systems for controlled gene expression

  • Biochemical validation:

    • In vitro assays with purified components

    • Direct binding or transport assays

    • Reconstitution experiments in defined systems

  • Genetic approaches:

    • Analysis of multiple independent lines with varying cemA expression

    • Complementation with wild-type cemA to restore phenotypes

    • Expression of cemA variants with specific functional domains altered

  • Combinatorial analyses:

    • Epistasis analysis with genes in related pathways

    • Double mutant analysis to identify genetic interactions

    • Suppressor screens to identify compensatory mechanisms

  • Targeted metabolomics:

    • Focus on metabolites directly related to hypothesized cemA function

    • Flux analysis using stable isotope labeling

    • Comparison with known transporter mutant profiles

When interpreting results, researchers should consider that chloroplast envelope proteins often have overlapping functions, and compensatory mechanisms may mask phenotypes in single gene manipulations .

How might understanding cemA function contribute to improving plant stress tolerance in crop species?

Insights from cemA research could translate to agricultural applications:

  • Genetic engineering approaches:

    • Identification of cemA homologs in crop species

    • Modification of expression levels to enhance stress tolerance

    • Introduction of modified versions with enhanced activity

    • Tissue-specific or stress-inducible expression

  • Marker-assisted breeding:

    • Development of molecular markers based on cemA sequence variants

    • Selection for naturally occurring alleles associated with enhanced stress tolerance

    • Introgression of beneficial alleles into elite varieties

  • Potential applications based on function:

    • If involved in metabolite transport: Engineering improved nutrient use efficiency

    • If participating in cold acclimation: Developing varieties with enhanced freezing tolerance

    • If regulating cyanogenic compound production: Modifying plant defense responses

The differential regulation of chloroplast envelope proteins during cold acclimation, as demonstrated in search result , suggests that understanding cemA's role could be particularly valuable for improving cold tolerance in sensitive crop species.

What are the most promising directions for structural studies of cemA and related chloroplast envelope proteins?

Advancing structural understanding of cemA requires:

  • Membrane protein crystallography:

    • Optimization of detergent conditions for protein stability

    • Crystal screening with lipidic cubic phase methods

    • Use of antibody fragments to stabilize protein conformation

  • Cryo-electron microscopy:

    • Single-particle analysis of purified protein

    • Tomography of membrane fragments

    • In situ structural analysis in isolated chloroplasts

  • Integrative structural biology:

    • Combination of low-resolution structural data with computational modeling

    • Cross-linking mass spectrometry to define protein topology

    • Hydrogen-deuterium exchange to identify flexible regions

    • Molecular dynamics simulations to predict conformational changes

  • Structure-guided functional studies:

    • Design of mutations based on structural insights

    • Engineering of chimeric proteins to test domain functions

    • Development of specific inhibitors or activity modulators

Recent advances in membrane protein structural biology, particularly in cryo-EM techniques, offer promising approaches for understanding cemA structure at molecular resolution.

How can systems biology approaches integrate cemA function into broader models of chloroplast-nuclear communication?

Integrating cemA research into systems-level understanding requires:

  • Multi-omics integration:

    • Correlation of cemA expression with transcriptome, proteome, and metabolome data

    • Network analysis to identify co-regulated genes and proteins

    • Identification of regulatory hubs connecting cemA to broader cellular processes

  • Chloroplast-nuclear signaling:

    • Analysis of retrograde signaling pathways affected by cemA manipulation

    • Investigation of nuclear transcription factors responding to cemA-dependent signals

    • Identification of metabolite signals potentially transported by cemA

  • Comparative systems analysis:

    • Cross-species comparison of cemA function and regulation

    • Evolutionary analysis of chloroplast envelope protein networks

    • Identification of conserved and species-specific regulatory mechanisms

  • Predictive modeling:

    • Development of mathematical models incorporating cemA function

    • Simulation of metabolite flux changes during stress responses

    • Integration of cemA into whole-cell models of plant metabolism

The central role of chloroplasts in plant metabolism and stress responses suggests that cemA function likely integrates with multiple cellular processes, potentially serving as a nexus for coordination between organellar and nuclear responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.