Recombinant Nandina domestica NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Nandina domestica (Heavenly bamboo)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinones within the photosynthetic and potentially chloroplast respiratory chains, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, the primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Nandina domestica NAD(P)H-quinone oxidoreductase subunit 3, and what is its role in plant metabolism?

NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) from Nandina domestica is a protein component of the NAD(P)H dehydrogenase complex located in chloroplasts. This complex plays a crucial role in cyclic electron flow around photosystem I, which is essential for photoprotection and optimization of photosynthesis under stress conditions. The ndhC subunit specifically contributes to the membrane domain of the complex, facilitating electron transfer from NAD(P)H to plastoquinone in the electron transport chain . Methodologically, researchers investigating this protein's function typically employ comparative genomics, biochemical assays of electron transport chain components, and fluorescence measurements to assess photosynthetic efficiency under varying environmental conditions.

How is recombinant Nandina domestica ndhC protein typically produced for research purposes?

Recombinant Nandina domestica ndhC protein is typically produced using an E. coli expression system with an N-terminal His-tag for purification purposes . The methodological workflow involves:

  • Gene synthesis or PCR amplification of the ndhC gene from Nandina domestica chloroplast DNA

  • Cloning into an appropriate expression vector containing a His-tag sequence

  • Transformation into an E. coli expression strain optimized for membrane proteins

  • Induction of protein expression under controlled conditions

  • Cell lysis and membrane fraction isolation

  • Solubilization with appropriate detergents

  • Affinity chromatography purification using Ni-NTA resin

  • Quality control by SDS-PAGE (ensuring >90% purity)

  • Lyophilization and storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with glycerol addition (5-50% final concentration) for long-term storage at -20°C/-80°C .

How should researchers design experiments to study the function of recombinant Nandina domestica ndhC protein?

When designing experiments to study recombinant Nandina domestica ndhC protein function, researchers should follow these methodological steps:

  • Define research variables:

    • Independent variables: Protein concentration, environmental conditions (light intensity, temperature, salt stress)

    • Dependent variables: Electron transport rate, complex assembly efficiency, photosynthetic parameters

    • Control variables: Buffer composition, pH, temperature

  • Formulate testable hypotheses: For example, "Recombinant ndhC incorporation into thylakoid membranes increases cyclic electron flow rates under high light stress conditions."

  • Design experimental treatments:

    • Protein reconstitution in liposomes at varying concentrations

    • Incorporation into thylakoid membranes of ndhC-deficient mutants

    • Exposure to different environmental stressors

  • Implement appropriate controls:

    • Negative controls: Empty liposomes, inactive protein variants

    • Positive controls: Native protein complex, known functional homologs

  • Measurement methodology selection:

    • Spectroscopic techniques for electron transfer kinetics

    • Chlorophyll fluorescence for photosynthetic parameters

    • Blue native PAGE for complex assembly analysis

This systematic approach ensures robust experimental design that minimizes confounding variables and maximizes the validity of findings regarding ndhC function.

What are the critical factors for proper reconstitution and storage of recombinant Nandina domestica ndhC protein?

Proper reconstitution and storage of recombinant Nandina domestica ndhC protein is essential for maintaining its structural integrity and functional properties. Critical factors include:

ParameterRecommended ConditionsRationaleMonitoring Method
Initial handlingBrief centrifugation before openingEnsures content collection at vial bottomVisual inspection
Reconstitution mediumDeionized sterile waterPrevents contamination and ionic interferencepH and conductivity testing
Protein concentration0.1-1.0 mg/mLMaintains optimal stability-solubility balanceBradford/BCA assay
Cryoprotectant5-50% glycerol (final concentration)Prevents ice crystal formationVisual inspection after freeze-thaw
AliquotingSmall single-use volumesMinimizes freeze-thaw cyclesN/A
Storage temperature-20°C/-80°C long-termMinimizes degradationStability testing by SDS-PAGE
Storage bufferTris/PBS-based buffer with 6% trehalose, pH 8.0Stabilizes protein structurepH monitoring
Freeze-thaw cyclesMinimize, avoid repeated cyclesPrevents denaturationActivity assays after each cycle

Researchers should implement a quality control protocol including SDS-PAGE analysis and functional assays after reconstitution to ensure protein integrity has been maintained . For membrane proteins like ndhC, addition of appropriate detergents or lipids may be necessary to maintain native-like conformation in solution.

How can researchers verify the functional integrity of purified recombinant Nandina domestica ndhC protein?

Verification of functional integrity for purified recombinant Nandina domestica ndhC protein requires a multi-faceted approach:

  • Structural integrity assessment:

    • SDS-PAGE analysis for size verification and purity (>90% purity expected)

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Limited proteolysis to assess proper folding

  • Membrane incorporation capacity:

    • Liposome reconstitution efficiency measurement

    • Sucrose gradient centrifugation for membrane association verification

    • Freeze-fracture electron microscopy for visualization of membrane insertion

  • Functional assays:

    • NADPH oxidation activity measurement using spectrophotometric assays

    • Electron transfer capacity to quinone analogs

    • Reconstitution with other NDH complex subunits to assess complex formation

  • Comparative analysis:

    • Functional comparison with native chloroplast ndhC

    • Activity benchmarking against homologous proteins from model organisms

The resulting data should be analyzed using appropriate statistical methods with replication to ensure reliability and reproducibility of findings, as emphasized in proper experimental design methodology .

How can researchers utilize Nandina domestica ndhC to investigate plant stress responses and adaptation mechanisms?

Recombinant Nandina domestica ndhC protein serves as a valuable tool for investigating plant stress response mechanisms, particularly in relation to photosynthetic adaptation. Methodological approaches include:

  • Stress response systems reconstruction:

    • Reconstitution of recombinant ndhC with other NDH complex components to create minimal functional systems

    • Integration into thylakoid membranes of model organisms with disabled endogenous ndhC

    • Exposure to controlled stress conditions (high light, drought, temperature extremes)

  • Comparative stress physiology:

    • Functional comparison between Nandina domestica ndhC and homologs from plants with different ecological adaptations

    • Analysis of sequence variations that correlate with environmental adaptations

    • Site-directed mutagenesis to identify critical residues for stress response functionality

  • Quantum efficiency analysis:

    • Measurement of cyclic electron flow efficiency under various stress conditions

    • Assessment of photosystem I to photosystem II coordination

    • Determination of ATP/NADPH ratio modulation capacity

  • Integration with omics approaches:

    • Correlation of ndhC function with transcriptomic changes under stress

    • Metabolomic analysis of energy-related metabolites

    • Proteomic investigation of interaction partners under different conditions

This multidisciplinary approach leverages recombinant ndhC as a probe to understand the molecular mechanisms underlying Nandina domestica's documented adaptability to various environmental conditions , with potential applications in engineering stress tolerance in crops.

How does Nandina domestica ndhC structure-function relationship compare to homologs in other species?

Understanding the structure-function relationship of Nandina domestica ndhC compared to homologs in other species requires sophisticated comparative analysis:

SpeciesKey Structural DifferencesFunctional ImplicationsEvolutionary Context
Nandina domestica120 amino acids, hydrophobic transmembrane regionsAdaptation to temperate climate conditionsBerberidaceae family, evergreen shrub
Arabidopsis thaliana~85% sequence similarity, variations in loop regionsModel organism standard, moderate stress toleranceBrassicaceae family, annual plant
Rice (Oryza sativa)Modifications in quinone-binding domainsAdaptation to high light tropical conditionsPoaceae family, crop species
CyanobacteriaEvolutionarily distant, simpler structureAncient photosynthetic machineryProkaryotic ancestor of chloroplasts
Chlamydomonas reinhardtiiMissing in some strainsAlternative electron flow strategiesAlgal photosynthetic model

Research methodologies to investigate these relationships include:

  • Molecular phylogenetic analysis using maximum likelihood methods to trace evolutionary conservation of functional domains

  • Homology modeling to predict structural differences based on amino acid sequence variations

  • Chimeric protein construction by domain swapping between species to identify functional determinants

  • Complementation studies in model organisms with ndhC knockouts to assess functional interchangeability

  • Molecular dynamics simulations to predict how sequence differences affect protein behavior in membranes

This comparative approach reveals how evolutionary adaptations in ndhC structure contribute to species-specific photosynthetic efficiency and stress tolerance mechanisms, potentially informing bioengineering efforts for climate resilience .

What are the potential mechanisms by which Nandina domestica ndhC contributes to the documented medicinal properties of the plant?

While direct evidence linking ndhC specifically to Nandina domestica's medicinal properties is limited, several hypothetical mechanisms can be proposed based on its role in photosynthetic metabolism and the plant's documented bioactivities:

  • Indirect influence on secondary metabolite production:

    • ndhC's role in photosynthetic electron transport affects ATP and NADPH availability

    • These energy carriers are critical for biosynthesis of isoquinoline alkaloids and other bioactive compounds in Nandina domestica

    • Methodology: Correlation analysis between ndhC expression levels and quantitative profiling of medicinal compounds under various conditions

  • Stress response coordination:

    • ndhC-containing NDH complex modulates plant responses to environmental stressors

    • Stress conditions trigger production of protective secondary metabolites with medicinal properties

    • Methodology: Analysis of regulatory networks connecting photosynthetic electron transport and secondary metabolism

  • Evolutionary co-adaptation:

    • Specialized metabolism in Nandina domestica may have co-evolved with photosynthetic adaptations

    • ndhC variations may reflect adaptation to ecological niches that also drove medicinal compound production

    • Methodology: Comparative genomics and transcriptomics across Berberidaceae family members with varying medicinal properties

  • Potential direct interactions:

    • While highly speculative, chloroplast proteins can sometimes moonlight in secondary roles

    • Investigation methodology: Protein-protein interaction studies, subcellular localization under stress conditions

To investigate these hypotheses, researchers should employ systems biology approaches integrating transcriptomics, metabolomics, and functional genomics to map the regulatory networks connecting primary metabolism (including ndhC function) to the production of the 366+ documented bioactive compounds in Nandina domestica .

How can researchers address data contradictions when studying recombinant protein function across different experimental systems?

When studying recombinant Nandina domestica ndhC across different experimental systems, researchers may encounter contradictory results. Addressing these contradictions requires a systematic approach:

What statistical approaches are most appropriate for analyzing functional differences between native and recombinant Nandina domestica ndhC?

Analysis GoalRecommended Statistical ApproachData RequirementsImplementation Considerations
Activity comparisonPaired t-tests or Wilcoxon signed-rank testsMatched samples, normalized activity measurementsControl for protein concentration differences
Kinetic parameter differencesNonlinear regression with extra sum-of-squares F testMultiple substrate concentrations, replicated reactionsAccount for potential cooperativity
Stability comparisonSurvival analysis (e.g., Kaplan-Meier with log-rank test)Time-to-denaturation data under stress conditionsEnsure proportional hazards assumption validity
Structural similarityRMSD analysis of spectroscopic dataCD spectra, fluorescence measurementsNormalize for concentration differences
Multi-parameter functional comparisonMultivariate analysis (PCA, MANOVA)Multiple functional parameters measured on same samplesCheck for multivariate normality
System-level effectsMixed-effects modelsNested data from multiple experimental runsAccount for random and fixed effects appropriately

For implementation:

  • Establish clear null hypotheses (e.g., "No difference in electron transport rate between native and recombinant ndhC")

  • Determine appropriate sample sizes through power analysis

  • Apply rigorous randomization in experimental design

  • Consider Bayesian approaches when prior knowledge can be incorporated

  • Implement appropriate corrections for multiple comparisons (e.g., Bonferroni, FDR)

This statistical framework ensures rigorous comparison while accounting for the inherent variability in biochemical assays and the potential structural differences between native and recombinant forms of the protein.

How can advanced imaging techniques be applied to study the incorporation and function of recombinant Nandina domestica ndhC in membrane systems?

Advanced imaging techniques provide powerful approaches for visualizing the incorporation and function of recombinant Nandina domestica ndhC in membrane systems:

  • Super-resolution microscopy methodologies:

    • Stimulated Emission Depletion (STED) microscopy: Visualize ndhC distribution in reconstituted membranes with resolution below diffraction limit

    • Photoactivated Localization Microscopy (PALM): Track single molecule dynamics of fluorescently-tagged ndhC

    • Implementation protocol: Expression with photoconvertible fluorescent protein tags in minimal interference positions

  • Electron microscopy approaches:

    • Cryo-electron microscopy: Visualize membrane-embedded ndhC in near-native state

    • Immunogold labeling with transmission electron microscopy: Precise localization within membrane complexes

    • Tomographic reconstruction: 3D visualization of ndhC-containing complexes

    • Sample preparation protocol: Vitrification of reconstituted membranes on holey carbon grids

  • Spectroscopic imaging techniques:

    • Förster Resonance Energy Transfer (FRET): Measure protein-protein interactions between ndhC and partner proteins

    • Fluorescence Recovery After Photobleaching (FRAP): Assess mobility of ndhC within membranes

    • Fluorescence Correlation Spectroscopy (FCS): Analyze diffusion properties and complex formation

  • Functional imaging applications:

    • Membrane potential-sensitive dyes: Visualize electron transport activity in real-time

    • Local pH indicators: Track proton translocation associated with ndhC function

    • Calcium imaging: Monitor signaling events potentially linked to ndhC activity

Data analysis for these techniques requires specialized software for image processing, including deconvolution algorithms, particle tracking, and colocalization analysis. Quantitative parameters such as diffusion coefficients, complex size distributions, and activity correlation maps can be extracted to characterize the functional integration of recombinant ndhC in membrane systems with unprecedented spatial and temporal resolution.

What are the most promising approaches for studying the role of ndhC in the medicinal properties of Nandina domestica?

Future research on ndhC's potential role in Nandina domestica's medicinal properties should focus on these methodological approaches:

  • Transgenic modification studies:

    • Development of ndhC overexpression and knockout lines in Nandina domestica

    • Comparative metabolomic profiling of medicinal compounds between wild-type and modified plants

    • Challenge experiments with environmental stressors to assess impact on bioactive compound production

  • Regulatory network mapping:

    • Transcriptomic analysis correlating ndhC expression with biosynthetic pathways of known medicinal compounds

    • ChIP-seq studies to identify transcription factors co-regulating photosynthetic and secondary metabolism genes

    • Network pharmacology approaches linking plant metabolic networks to therapeutic targets

  • Evolutionary medicine perspective:

    • Comparative genomic analysis of ndhC sequence variations across Nandina species with differing medicinal properties

    • Ecological correlation studies between environmental adaptation and medicinal compound production

    • Ancestral sequence reconstruction to understand evolutionary trajectory of ndhC in medicinal plants

  • Therapeutic potential investigation:

    • Evaluation of plant extracts from ndhC-modified plants for anti-inflammatory, antimicrobial, and antitumor activities

    • Isolation and characterization of compounds uniquely affected by ndhC modulation

    • In vitro and in vivo testing of biological activities in disease models

These approaches bridge the gap between basic photosynthetic research and traditional medicine, potentially revealing new insights into how primary metabolism influences the production of the 366+ bioactive compounds documented in Nandina domestica .

How might synthetic biology approaches utilize recombinant Nandina domestica ndhC to enhance photosynthetic efficiency in crop plants?

Synthetic biology offers innovative strategies to leverage recombinant Nandina domestica ndhC for enhancing photosynthetic efficiency in crops:

  • Optimized ndhC variant design:

    • Computational design of ndhC variants with enhanced electron transport properties

    • Directed evolution approaches to select for improved functionality under stress conditions

    • Domain swapping between Nandina domestica ndhC and crop homologs to create optimized chimeras

  • Alternative NDH complex engineering:

    • Creation of minimal synthetic NDH complexes incorporating Nandina domestica ndhC

    • Expression of these engineered complexes in crop chloroplasts

    • Optimization of subunit stoichiometry for maximal cyclic electron flow efficiency

  • Metabolic pathway integration:

    • Engineering of regulatory links between enhanced NDH activity and carbon fixation pathways

    • Modulation of ATP/NADPH ratio through controlled expression of ndhC variants

    • Integration with photorespiratory bypasses for comprehensive photosynthetic improvement

  • Multi-omics guided implementation:

    • Systems biology modeling to predict effects of ndhC modifications on crop metabolism

    • Design-build-test-learn cycles with progressively refined implementations

    • Integration with genome editing technologies for precise chromosomal integration

The methodological approach should include:

  • Transformation protocols optimized for chloroplast targeting

  • Phenotypic screening under relevant stress conditions (drought, high light, temperature extremes)

  • Photosynthetic efficiency measurements (gas exchange, chlorophyll fluorescence, 13C discrimination)

  • Yield and biomass accumulation quantification under field conditions

This synthetic biology framework provides a pathway from fundamental research on Nandina domestica ndhC to practical applications in improving crop resilience and productivity under changing climate conditions.

What challenges remain in fully characterizing the structure and function of Nandina domestica ndhC, and how might they be addressed?

Despite advances in recombinant protein technology, several significant challenges remain in fully characterizing Nandina domestica ndhC:

  • Structural determination challenges:

    • Membrane protein crystallization difficulties

    • Potential solutions:

      • Lipidic cubic phase crystallization techniques

      • Cryo-EM single particle analysis of reconstituted complexes

      • Integration of AlphaFold2 predictions with experimental constraints

      • Hydrogen-deuterium exchange mass spectrometry for dynamics information

  • Functional characterization limitations:

    • Complexity of measuring activity within multi-subunit complexes

    • Methodological approaches:

      • Development of simplified in vitro assay systems

      • Single-molecule techniques to observe individual electron transfer events

      • Implementation of genetically encoded sensors for electron flow in vivo

      • Optogenetic approaches to control ndhC activity with light

  • Physiological relevance assessment:

    • Connecting molecular function to whole-plant physiology

    • Experimental strategies:

      • Development of conditional expression systems in Nandina domestica

      • Non-invasive imaging of electron transport in intact plants

      • Integration of multi-omics data across organizational scales

      • Comparative studies across diverse environmental conditions

  • Technical implementation barriers:

    • Limited genetic resources for Nandina domestica

    • Development needs:

      • Establishment of transformation protocols for Nandina domestica

      • Creation of inducible expression systems

      • Development of Nandina-specific antibodies for immunodetection

      • Assembly and annotation of comprehensive Nandina domestica genome

Addressing these challenges requires interdisciplinary collaboration between structural biologists, biochemists, plant physiologists, and computational biologists, potentially yielding insights applicable not only to understanding Nandina domestica's traditional medicinal applications but also to fundamental questions in photosynthetic energy conversion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.