Recombinant Narcissus mosaic virus Movement protein TGB2 (ORF3)

Shipped with Ice Packs
In Stock

Description

Role in Viral Movement

The TGB2 protein is essential for the movement of the virus from one plant cell to another. It is generally accepted that TGB2 and TGB3 are required for the transport of TGB1 to plasmodesmata, which are channels between plant cells . TGB2 might direct the TGB1 protein to plasmodesmata-associated sites .

Interactions with Other Proteins

TGB2 interacts with TGB1 and TGB3 proteins .

Localization

The TGB1 proteins encoded by Alternanthera mosaic virus and Narcissus mosaic virus can localize in the nucleus and nucleolus, which is essential for the efficient suppression of RNA silencing .

TGB Classes

The TGB2 protein is highly conserved in both potex-like and hordei-like TGB classes .

Recombinant Production

Recombinant TGB2 (ORF3) protein can be expressed in E. coli with an N-terminal His tag .

Applications of NMV Vectors

Narcissus Mosaic Virus (NMV) vectors can be employed for protein expression, protein subcellular localization and secondary metabolite production .

Tables

Table 1: Recombinant Full Length Narcissus mosaic virus Movement Protein Tgb2 (Orf3) Protein, His-Tagged

Cat.No. :RFL16507NF
Product Overview :Recombinant Full Length Narcissus mosaic virus Movement protein TGB2 (ORF3) Protein (P15097) (1-130aa), fused to N-terminal His tag, was expressed in E. coli.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its use in production.
Synonyms
ORF3; Movement protein TGB2; 14 kDa protein; Triple gene block 2 protein; TGBp2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Narcissus mosaic virus (NMV)
Target Names
ORF3
Target Protein Sequence
MPGLTPPVNYEQVYKVLAIGFLLCASIYCLRSNHLPHVGDNIHSLPHGGNYADGTKRVQY FRPHSSTSTNHKYTALCAVLTLSLLIFAQTRLAAGNRITSVSICHHCSSQGSLSGGNHGR VSGHSELPTT
Uniprot No.

Target Background

Function

This protein plays a crucial role in plant viral cell-to-cell movement. It facilitates the transport of the viral genome to neighboring plant cells via plasmodesmata.

Database Links

KEGG: vg:1494018

Protein Families
Tymovirales TGBp2 protein family
Subcellular Location
Host endoplasmic reticulum membrane.

Q&A

What is Narcissus mosaic virus Movement protein TGB2 (ORF3) and what is its role in viral pathogenesis?

The Narcissus mosaic virus Movement protein TGB2 (ORF3) is a 130 amino acid protein that plays a critical role in viral cell-to-cell propagation by facilitating genome transport to neighboring plant cells through plasmodesmata . It belongs to the Tymovirales TGBp2 protein family and functions as part of the Triple Gene Block (TGB) system, which comprises three proteins (TGB1, TGB2, and TGB3) that collectively enable virus movement throughout the plant .

Movement proteins like TGB2 are dedicated to enlarging the pore size of plasmodesmata and actively transporting viral nucleic acids into adjacent cells, thereby allowing both local and systemic spread of viruses in plants . In the context of Narcissus mosaic virus infection, TGB2 represents a key component in the virus's ability to spread from the initial infection site throughout the host plant.

How does TGB2 interact with other TGB proteins in the viral movement complex?

TGB2 functions in coordination with TGB1 and TGB3 proteins to facilitate viral movement. The interaction between these proteins follows a specific pattern:

  • TGB3 serves as the "driving force" for intracellular transport of the TGB complex to plasmodesmata-associated sites .

  • TGB2 and TGB3 travel to their destinations in specific membrane containers such as vesicles formed in a COPII-independent manner or ER-specific membrane rafts .

  • TGB2/TGB3-containing membrane structures interact with movement-competent ribonucleoprotein complexes (RNPs) containing TGB1 .

The interaction dynamics can be visualized in the following scheme:

  • TGB1 binds viral RNA and functions in silencing suppression (in potexviruses) or long-distance movement (in hordeiviruses)

  • TGB2 and TGB3 form a membrane-associated complex that targets plasmodesmata

  • This complex facilitates the delivery of TGB1-RNA complexes to and through plasmodesmata

This coordinated action is essential for efficient viral cell-to-cell movement in infected plants.

What are the optimal conditions for expression and purification of Recombinant Narcissus mosaic virus Movement protein TGB2?

Based on protocols for similar recombinant proteins, the optimal conditions for expression and purification of Recombinant Narcissus mosaic virus Movement protein TGB2 are:

Expression Protocol:

  • Transform E. coli with an expression vector containing the TGB2 (ORF3) gene fused to an N-terminal His tag .

  • Culture in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8.

  • Induce protein expression with IPTG (typically 0.2-1.0 mM) and incubate at lower temperature (16-25°C) overnight to enhance solubility.

  • Harvest cells by centrifugation and lyse using sonication or pressure-based methods in a buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10 mM imidazole

    • Protease inhibitors

Purification Protocol:

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Purify using Ni-NTA affinity chromatography:

    • Binding: Load clarified lysate onto Ni-NTA column

    • Washing: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole

    • Elution: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole

  • Dialyze against Tris/PBS-based buffer, pH 8.0

  • Lyophilize with 6% Trehalose as a stabilizing agent

  • Store at -20°C/-80°C

For reconstitution, briefly centrifuge the vial prior to opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C is recommended .

How can researchers effectively visualize and track TGB2 trafficking in plant cells?

To effectively visualize and track TGB2 trafficking in plant cells, researchers can employ several advanced microscopy techniques and experimental approaches:

Recommended Visualization Methods:

  • Fluorescent Protein Tagging:

    • Generate TGB2-GFP (or other fluorescent protein) fusion constructs

    • Express in plant cells via Agrobacterium-mediated transformation

    • Monitor localization using confocal laser scanning microscopy

    • Time-lapse imaging can reveal dynamic trafficking patterns

  • Immunofluorescence Approaches:

    • Develop specific antibodies against TGB2

    • Fix and permeabilize plant tissues

    • Perform immunostaining with fluorescently-labeled secondary antibodies

    • Co-staining with organelle markers can identify subcellular localization

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments are fused to TGB2 and potential interacting partners

    • Co-expression results in fluorescence when proteins interact

    • This approach can be used to visualize TGB2 interactions with TGB3 and other proteins in planta

  • Advanced Analysis Techniques:

    • Fluorescence Recovery After Photobleaching (FRAP) to study protein mobility

    • Fluorescence resonance energy transfer (FRET) to detect protein-protein interactions

    • Super-resolution microscopy for detailed subcellular localization

Research has shown that TGB2 trafficking to plasmodesmata-associated membrane structures is COPII-independent, employing an unconventional mechanism that doesn't involve exit from ER in COPII-transport vesicles . Using these visualization techniques, researchers can further characterize this unique trafficking pathway.

What experimental approaches can determine the functional domains of TGB2 important for viral movement?

Determining the functional domains of TGB2 important for viral movement requires a systematic approach combining mutagenesis, protein interaction studies, and functional assays:

Mutagenesis Strategies:

  • Alanine Scanning Mutagenesis:

    • Systematically replace clusters of amino acids with alanine

    • Express mutant proteins and assess their function in viral movement assays

    • Identify regions critical for protein function

  • Deletion Analysis:

    • Create a series of N-terminal and C-terminal truncations

    • Test each truncated protein for its ability to support viral movement

    • Map minimal functional domains

  • Targeted Mutagenesis:

    • Based on sequence conservation among TGB2 proteins

    • Focus on the transmembrane domains and the central conserved region

    • Substitute conserved residues with amino acids of different properties

Functional Analysis Methods:

  • Viral Movement Complementation Assays:

    • Use a TGB2-deficient virus construct labeled with a reporter gene (GFP)

    • Co-express with wild-type or mutant TGB2 proteins

    • Measure cell-to-cell movement by monitoring the spread of the reporter

  • Subcellular Localization Studies:

    • Fuse mutant TGB2 proteins with fluorescent tags

    • Determine if mutations affect localization to plasmodesmata

    • Correlate localization with movement function

  • Protein-Protein Interaction Assays:

    • Yeast two-hybrid, pull-down assays, or BiFC to detect interactions with TGB1 and TGB3

    • Determine if mutations disrupt these interactions

    • Correlate interaction capability with movement function

Research on related TGB proteins has shown that the C-terminal transmembrane domain is particularly important for intracellular targeting . In TGB3, the YQDLN motif is involved in protein oligomerization, which is essential for the functioning of targeting signals . Similar functional motifs likely exist in TGB2 and can be identified using these approaches.

How does TGB2 from Narcissus mosaic virus compare to homologous proteins from other plant viruses?

TGB2 from Narcissus mosaic virus (NMV) belongs to the potex-like Triple Gene Block system. Comparative analysis with homologous proteins reveals important similarities and differences:

Comparison Table of TGB2 Proteins from Different Viruses:

VirusTGB2 LengthKey FeaturesTransport MechanismReference
Narcissus mosaic virus130 aaTransmembrane domains, belongs to Tymovirales TGBp2 familyCOPII-independent trafficking to plasmodesmata
Potato virus X (Potexvirus)~110-130 aaSimilar membrane association patternFunctions in complex with TGB1 and TGB3, TGB1 acts as silencing suppressor
Barley stripe mosaic virus (Hordeivirus)~110-130 aaSimilar membrane topologyTGB1 forms non-virion RNPs, nuclear localization important for long-distance movement
Alternanthera mosaic virus (Potexvirus)~110-130 aaSimilar to NMV TGB2TGB1 partly localizes to nucleus, silencing suppression function

Key Evolutionary and Functional Insights:

  • The potex-like TGB system (including NMV) differs from the hordei-like system in several aspects:

    • In potexviruses, TGB1 proteins have silencing suppression activity and nuclear localization related to this function

    • In hordeiviruses, TGB1 nuclear localization is related to long-distance movement functions

    • Transport forms differ: TGB1-modified virions in potexviruses versus TGB1-formed non-virion RNPs in hordeiviruses

  • Despite these differences, core mechanisms are conserved:

    • All TGB2 proteins contain transmembrane domains

    • TGB2/TGB3 interactions form the basis for intracellular transport

    • TGB2 trafficking to plasmodesmata is COPII-independent across virus groups

This comparative analysis highlights that while the basic function of TGB2 in facilitating viral movement is conserved, the specific mechanisms and interactions with other viral proteins may vary between different virus groups.

What methodologies are most effective for studying TGB2-mediated membrane interactions?

Studying TGB2-mediated membrane interactions requires specialized techniques to understand protein-lipid and protein-membrane interactions. The following methodologies are most effective:

Biochemical and Biophysical Approaches:

  • Membrane Fractionation:

    • Differential centrifugation to isolate membrane fractions

    • Analyze TGB2 distribution between soluble and membrane fractions

    • Treatment with different detergents can reveal the strength of membrane association

  • Liposome Binding Assays:

    • Prepare liposomes with defined lipid compositions

    • Incubate with purified TGB2 protein

    • Measure binding affinity and specificity for different lipid compositions

    • Flotation assays can separate liposome-bound from free protein

  • Protein Topology Analysis:

    • Protease protection assays to determine which regions are protected by membranes

    • Glycosylation site insertion to map regions exposed to ER lumen

    • Fluorescence quenching experiments to determine orientation in membranes

Advanced Imaging Techniques:

  • Electron Microscopy:

    • Immunogold labeling of TGB2 in infected cells

    • Transmission electron microscopy to visualize membrane alterations

    • Cryo-electron microscopy for high-resolution structural details

  • Live Cell Imaging:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure lateral mobility within membranes

    • Single particle tracking of fluorescently tagged TGB2

    • Correlative light and electron microscopy (CLEM) to combine functional and structural data

Molecular and Genetic Approaches:

  • Membrane Protein Interaction Studies:

    • Split-ubiquitin yeast two-hybrid system (specifically designed for membrane proteins)

    • Co-immunoprecipitation with membrane protein extraction protocols

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to TGB2 in membranes

  • TGB2 Mutant Analysis:

    • Systematic mutation of hydrophobic domains predicted to interact with membranes

    • Assay mutants for membrane association and function in viral movement

    • Correlate membrane interaction with subcellular localization and function

Research on the related TGB3 protein has shown that it requires oligomerization (mediated by the YQDLN motif) for proper targeting . Similar mechanisms may apply to TGB2, and these methodologies can help elucidate the specific requirements for TGB2 membrane association and trafficking.

What are common challenges when working with Recombinant Narcissus mosaic virus Movement protein TGB2 and how can they be addressed?

Working with Recombinant Narcissus mosaic virus Movement protein TGB2 presents several challenges due to its hydrophobic nature and membrane association. Here are common challenges and their solutions:

Expression and Purification Challenges:

ChallengeSolutionRationale
Poor solubilityUse mild detergents (0.1% Triton X-100, 0.5% CHAPS) in purification buffersHydrophobic transmembrane domains cause aggregation in aqueous solutions
Low expression levelsLower induction temperature (16-18°C), use specialized E. coli strains (C41/C43)Membrane proteins often toxic to E. coli; lower temperatures reduce toxicity
Protein degradationAdd protease inhibitors, purify at 4°C, minimize handling timeMembrane proteins often susceptible to proteolysis
Loss of activity during storageAdd 6% trehalose as cryoprotectant, store at -80°C in small aliquots Prevents freeze-thaw damage and stabilizes protein structure
Protein aggregationInclude glycerol (5-10%) in storage buffer Prevents protein-protein interactions that lead to aggregation

Experimental Troubleshooting:

  • For functional assays:

    • Always include freshly purified protein as positive control

    • Verify protein integrity by SDS-PAGE before experiments

    • Avoid repeated freeze-thaw cycles; repeated freezing and thawing is not recommended

    • Store working aliquots at 4°C for up to one week

  • For structural studies:

    • Consider fusion with solubilizing tags (MBP, SUMO) that can be cleaved after purification

    • Use detergent screening to identify optimal conditions for structural stability

    • For crystallography, consider lipidic cubic phase methods specifically designed for membrane proteins

  • For interaction studies:

    • Maintain native membrane environment where possible

    • Use mild crosslinking to capture transient interactions

    • Consider nanodiscs or liposomes to maintain protein in lipid environment

How can researchers design effective experiments to study TGB2 interactions with host cell components?

Designing effective experiments to study TGB2 interactions with host cell components requires a multi-faceted approach:

Identification of Interacting Partners:

  • Yeast Two-Hybrid Screening:

    • Use modified membrane yeast two-hybrid systems suitable for membrane proteins

    • Screen against plant cDNA libraries to identify potential interacting proteins

    • Validate interactions using secondary assays

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged TGB2 in plant cells

    • Purify TGB2 complexes under conditions that maintain interactions

    • Identify co-purifying proteins by mass spectrometry

    • Include appropriate controls to eliminate false positives

  • Proximity-Based Labeling:

    • Fuse TGB2 to BioID or APEX2 enzymes

    • Express in plant cells and activate labeling

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach captures even transient or weak interactions

Validation and Characterization of Interactions:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse potential interacting partners to split fluorescent protein fragments

    • Co-express in plant cells and observe for fluorescence complementation

    • This confirms interactions and reveals subcellular locations

  • Co-localization Studies:

    • Use differently colored fluorescent tags for TGB2 and candidate interactors

    • Perform confocal microscopy to assess subcellular co-localization

    • Quantify co-localization using Pearson's or Manders' coefficients

  • Functional Validation:

    • Silence or knockout candidate host genes using VIGS or CRISPR

    • Assess impact on TGB2 localization and viral movement

    • Complement with mutated versions of the interacting protein

Experimental Design Considerations:

  • Tissue and cell type selection:

    • Use both Nicotiana benthamiana (standard model) and natural Narcissus hosts

    • Compare results between different cell types when possible

    • Consider developmental stage effects on interactions

  • Expression system selection:

    • Transient expression for rapid screening

    • Stable transgenic plants for long-term studies

    • Native expression levels to avoid artifacts from overexpression

  • Timing considerations:

    • Study early versus late infection time points

    • Capture dynamic changes in interactions during infection progression

Studies on related viral movement proteins have revealed interactions with components of the cellular trafficking machinery, cytoskeleton, and plasmodesmata. Specifically, some TGB proteins interact with nuclear proteins like fibrillarin and coilin , suggesting that exploring nuclear interactions of TGB2 might also yield interesting insights.

What are the most reliable methods for assessing TGB2 impact on plasmodesmatal structure and function?

Assessing TGB2 impact on plasmodesmatal structure and function requires specialized techniques that can detect subtle changes in these plant-specific intercellular junctions:

Structural Analysis Methods:

  • Electron Microscopy:

    • Transmission electron microscopy (TEM) of high-pressure frozen/freeze-substituted samples

    • Immunogold labeling to localize TGB2 within plasmodesmata

    • Serial section TEM or electron tomography for 3D reconstruction

    • Quantitative analysis of plasmodesmatal diameter, length, and substructure

  • Super-Resolution Microscopy:

    • Structured illumination microscopy (SIM) provides 2x resolution improvement

    • Stochastic optical reconstruction microscopy (STORM) for nanoscale resolution

    • Stimulated emission depletion (STED) microscopy for live-cell imaging

    • Label plasmodesmatal markers (e.g., callose, PDLP1) to visualize structural changes

Functional Analysis Methods:

  • Macromolecular Trafficking Assays:

    • Microinjection of fluorescent dextrans of different sizes

    • Photoactivation of caged fluorescent compounds

    • FRAP (Fluorescence Recovery After Photobleaching) to measure molecular flux

    • Quantify changes in size exclusion limit (SEL) of plasmodesmata

  • Cell-to-Cell Movement Assays:

    • Express TGB2 fused to fluorescent proteins in single cells

    • Monitor cell-to-cell spread of the fluorescent signal

    • Compare movement rates between wild-type and mutant TGB2 proteins

    • Co-express with other viral components to assess cooperative effects

  • Callose Deposition Analysis:

    • Stain for callose using aniline blue fluorochrome

    • Quantify callose deposition at plasmodesmata

    • Monitor dynamic changes in callose regulation

    • Assess effects of TGB2 on callose synthase activity and localization

Experimental Protocol Example:

To assess TGB2 impact on plasmodesmatal permeability:

  • Transiently express TGB2-GFP in N. benthamiana leaves using Agrobacterium infiltration

  • 48 hours post-infiltration, prepare 1 cm leaf discs from expressing regions

  • Infiltrate with fluorescent dextrans of different molecular weights (e.g., 10 kDa, 20 kDa, 40 kDa)

  • Allow dextrans to load for 20 minutes

  • Wash excess dextran and image using confocal microscopy

  • Quantify cell-to-cell movement of each dextran size

  • Compare with control tissues not expressing TGB2

Movement proteins like TGB2 are known to enlarge the pore size of plasmodesmata to actively transport viral nucleic acids into adjacent cells . The methods described above can precisely quantify these structural and functional changes to better understand the mechanisms involved.

What are promising new approaches for studying the structure-function relationships of TGB2 proteins?

Recent technological advances offer promising new approaches for studying structure-function relationships of TGB2 proteins:

Advanced Structural Determination:

  • Cryo-Electron Microscopy:

    • Single-particle cryo-EM for high-resolution structures of TGB2 in different conformational states

    • Cryo-electron tomography to visualize TGB2 in its native membrane environment

    • Subtomogram averaging to improve resolution of membrane-embedded structures

  • Integrative Structural Biology:

    • Combine multiple techniques (X-ray crystallography, NMR, SAXS, cryo-EM)

    • Molecular dynamics simulations to model TGB2-membrane interactions

    • Cross-linking mass spectrometry to identify protein-protein contact sites

  • Structural Proteomics:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes

    • Limited proteolysis coupled with mass spectrometry to identify flexible regions

    • Footprinting methods to identify protected regions upon interaction with partners

Functional Genomics and Editing:

  • CRISPR/Cas9 Applications:

    • Genome editing of host plants to modify potential interaction partners

    • Creation of viral mutants with precise alterations in TGB2

    • Base editing to introduce specific amino acid changes without disrupting reading frames

  • High-Throughput Mutational Scanning:

    • Deep mutational scanning to assess thousands of TGB2 variants simultaneously

    • Mutant libraries coupled with selection for functional viral movement

    • Computational analysis to build predictive models of structure-function relationships

Advanced Imaging and Tracking:

  • Single-Molecule Tracking:

    • Track individual TGB2 molecules in living cells using photoactivatable fluorescent proteins

    • Determine diffusion coefficients and movement patterns within membranes

    • Identify barriers and preferred routes for TGB2 trafficking

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine functional imaging of fluorescently tagged TGB2 with ultrastructural analysis

    • Precise localization of TGB2 relative to cellular structures

    • Track dynamic processes with light microscopy then capture snapshots with EM

  • Expansion Microscopy:

    • Physical expansion of samples to improve resolution of standard microscopes

    • Visualize fine details of TGB2 localization and interactions at plasmodesmata

    • Compatible with standard fluorescence microscopes

These emerging approaches promise to provide unprecedented insights into how TGB2 structure relates to its function in viral movement, potentially leading to new strategies for controlling viral diseases in plants.

How can knowledge of TGB2 function be applied to develop novel antiviral strategies for plant protection?

Understanding TGB2 function opens several avenues for developing novel antiviral strategies:

Target-Based Approaches:

  • Small Molecule Inhibitors:

    • High-throughput screening for compounds that bind TGB2

    • Structure-based design of inhibitors targeting conserved functional domains

    • Development of peptidomimetics that disrupt TGB2 interactions with other viral or host proteins

    • Potential screening protocol:

      • Express TGB2 with fluorescent tag in plant protoplasts

      • Add candidate compounds and monitor changes in TGB2 localization

      • Select compounds that disrupt normal trafficking patterns

  • RNA Interference (RNAi):

    • Design dsRNAs targeting conserved regions of TGB2 genes

    • Expression in transgenic plants to confer broad-spectrum resistance

    • Application as spray-on dsRNA for temporary protection

  • Engineered Resistance Proteins:

    • Develop decoy proteins that interact with TGB2 but block its function

    • Express modified host factors that recognize and trigger immunity upon TGB2 detection

    • Create dominant-negative TGB2 variants that disrupt viral movement

Host-Focused Strategies:

  • Manipulation of Host Factors:

    • Identify and modify host proteins essential for TGB2 function

    • Edit genes encoding plasmodesmata components to prevent TGB2-mediated modifications

    • Enhance natural defense responses targeting viral movement

  • Callose Regulation:

    • Develop compounds that trigger callose deposition at plasmodesmata upon viral infection

    • Engineer plants with inducible callose synthase expression

    • Target callose degradation pathways to maintain higher baseline callose levels

Translational Research Table:

ApproachMechanismAdvantagesChallengesDevelopment Stage
TGB2 inhibitor compoundsDirect binding to disrupt functionPotentially broad-spectrumDelivery to all plant tissuesTarget identification phase
RNAi targeting TGB2Degradation of viral mRNAHighly specificVirus escape through mutationsField trials in some crops
TGB2-triggered immunityRecognition of TGB2 activates plant defensesLeverages natural plant immunityEngineering recognition specificityProof-of-concept
Modified plasmodesmataAlter structure to prevent TGB2 functionPotentially durable resistanceMay affect normal plant developmentBasic research

Movement proteins like TGB2 are particularly attractive targets for antiviral strategies because they are essential for viral spread within the plant but not directly involved in virus replication. Disrupting viral movement can effectively contain infections at their initial sites and prevent systemic spread .

How does the TGB system in Narcissus mosaic virus compare with other viral movement strategies?

The TGB system in Narcissus mosaic virus represents one of several strategies evolved by plant viruses for cell-to-cell movement. A comprehensive comparison reveals key differences and similarities:

Comparative Analysis of Plant Viral Movement Strategies:

Movement SystemRepresentative VirusesKey ProteinsMovement FormHost ManipulationReference
Triple Gene Block (TGB)Narcissus mosaic virus, Potexviruses, HordeivirusesTGB1, TGB2, TGB3Virions (potex-like) or RNPs (hordei-like)Modified plasmodesmata
Single MPTobamoviruses (TMV)30K proteinViral RNPsIncreased SEL, cytoskeleton association
Tubule-forming MPsComoviruses, NepovirusesMovement proteinVirions in tubulesTubule formation through plasmodesmata
ClosterovirusBeet yellows virusHSP70h, p64, CPmVirionsSpecialized inclusion bodies-
BegomovirusGeminivirusesBC1, BV1Nuclear export and cell-to-cell movementNuclear shuttle and movement proteins-

Functional Comparisons:

  • Plasmodesmata Modification:

    • TGB system: TGB2 and TGB3 localize to plasmodesmata and facilitate TGB1-mediated RNA transport

    • Tobamovirus 30K: Directly modifies plasmodesmata structure and increases size exclusion limit

    • Tubule-forming: Replaces plasmodesmata structure with protein tubules for virion passage

  • Viral Form During Movement:

    • Potex-like TGB (including NMV): Modified virions as transport form

    • Hordei-like TGB: Non-virion ribonucleoprotein complexes (RNPs)

    • Single MP: Typically non-virion nucleoprotein complexes

    • Tubule-forming: Intact virions move through tubules

  • Subcellular Trafficking Mechanisms:

    • TGB system: COPII-independent trafficking to plasmodesmata

    • Single MP: Microtubule-associated trafficking

    • Closterovirus: Specialized vesicles and virion-associated HSP70h

The TGB system of Narcissus mosaic virus represents a sophisticated movement strategy that involves coordination between three different proteins. What makes it particularly interesting is the specialized membrane association of TGB2 and TGB3, and their COPII-independent trafficking to plasmodesmata , which represents an unconventional pathway for protein transport within plant cells.

What systems biology approaches can provide comprehensive insights into TGB2 function within the viral infection cycle?

Systems biology approaches can provide holistic understanding of TGB2 function within the viral infection cycle by integrating multiple data types and analytical methods:

Multi-Omics Integration:

  • Transcriptomics:

    • RNA-seq analysis of host responses to TGB2 expression

    • Time-course studies during infection to correlate TGB2 expression with host gene changes

    • Comparison between wild-type and TGB2-mutant virus infections

    • Analysis workflow:

      • Identify differentially expressed genes (DEGs) in response to TGB2

      • Perform pathway enrichment analysis

      • Identify transcription factors potentially regulating the response

  • Proteomics:

    • Quantitative proteomics to identify changes in protein abundance and modification

    • Phosphoproteomics to identify signaling pathways affected by TGB2

    • Spatial proteomics to track protein relocalization during infection

    • Focus on membrane proteins and plasmodesmata-associated proteins

  • Metabolomics:

    • Targeted analysis of defense-related metabolites

    • Lipid profiling to detect membrane composition changes induced by TGB2

    • Correlation of metabolic changes with virus movement efficiency

Network Biology Approaches:

  • Protein-Protein Interaction Networks:

    • Construct TGB2-centered interaction networks

    • Identify hub proteins that may be critical for TGB2 function

    • Compare networks between different plant hosts and virus strains

  • Gene Regulatory Networks:

    • Identify transcription factors responding to TGB2 expression

    • Model regulatory cascades activated during infection

    • Predict key regulators that could be targeted to disrupt viral movement

  • Flux Balance Analysis:

    • Model changes in metabolic fluxes during infection

    • Identify metabolic bottlenecks that could be targeted for antiviral development

    • Link metabolic changes to membrane composition and plasmodesmata function

Computational and Mathematical Modeling:

  • Agent-Based Modeling:

    • Simulate TGB2 movement and interactions at subcellular level

    • Model cell-to-cell spread based on TGB2 parameters

    • Predict effects of mutations or inhibitors on viral spread

  • Ordinary Differential Equation Models:

    • Develop kinetic models of TGB2-mediated processes

    • Parameterize using experimental data

    • Perform sensitivity analysis to identify critical parameters

  • Machine Learning Applications:

    • Train models to predict TGB2 interactions from sequence data

    • Classify plant responses to different TGB2 variants

    • Identify patterns in multi-omics data that correlate with successful viral movement

These systems biology approaches can reveal emergent properties of TGB2 function that would not be apparent from reductionist approaches alone, providing a comprehensive understanding of how this protein contributes to viral infection within the complex context of plant cellular systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.