Recombinant Nasalis larvatus C-C chemokine receptor type 5 (CCR5)

Shipped with Ice Packs
In Stock

Description

Functional Significance

CCR5 is a seven-transmembrane GPCR involved in immune cell migration (chemotaxis) and inflammatory responses . Its ligands include chemokines such as CCL3 (MIP-1α), CCL4 (MIP-1β), and CCL5 (RANTES), which regulate T-cell trafficking and macrophage activation . In HIV research, CCR5 serves as a primary co-receptor for viral entry, making it a therapeutic target for inhibitors like maraviroc .

  • Key roles:

    • Facilitates HIV-1 entry into host cells via interaction with viral gp120 .

    • Mediates leukocyte recruitment to inflammation sites .

    • Modulates synaptic plasticity and memory suppression in the brain .

Research Applications

This recombinant protein is utilized in:

  • Structural studies: CCR5’s transmembrane topology and ligand-binding mechanisms are analyzed using cryo-EM and X-ray crystallography . For example, the N-terminal domain and extracellular loops form critical binding interfaces for chemokines like CCL5 .

  • HIV inhibition assays: Compounds targeting CCR5 (e.g., AOP-RANTES, NNY-RANTES) are tested for blocking viral entry .

  • Cross-species virology: Non-human primate CCR5 variants, including Nasalis larvatus, help study HIV adaptation and zoonotic potential .

Comparative Insights

While human and Nasalis CCR5 share 92% sequence homology, subtle differences in extracellular loops impact ligand binding and viral tropism . For instance:

  • The V3 loop of HIV gp120 interacts with CCR5’s extracellular domains, and mutations here alter coreceptor specificity .

  • Nasalis CCR5’s conserved disulfide bonds (Cys28–Cys274) stabilize its tertiary structure, similar to human CCR5 .

Technical Considerations

  • Storage: Lyophilized protein remains stable at -80°C but degrades upon repeated thawing .

  • Activity assays: Functional validation requires reconstitution in lipid bilayers or cell membranes to preserve GPCR conformation .

  • Safety: Not for human therapeutic use due to potential immunogenicity .

Future Directions

Research priorities include:

  • Characterizing Nasalis CCR5’s interaction with primate-specific HIV strains.

  • Developing CRISPR-based gene editing tools to study CCR5 knockout effects in vivo .

  • Engineering thermostable mutants for structural biology applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD antigen CD195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Nasalis larvatus (Proboscis monkey)
Target Names
Target Protein Sequence
MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAARWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Uniprot No.

Target Background

Function
This receptor binds to a number of inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, subsequently initiating signal transduction by increasing intracellular calcium ion levels. It may play a role in controlling granulocytic lineage proliferation or differentiation. It participates in T-lymphocyte migration to infection sites by acting as a chemotactic receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.