Recombinant Nasturtium officinale Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your required tag type for prioritized development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Nasturtium officinale (Water-cress) (Rorippa nasturtium-aquaticum)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPDKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant Nasturtium officinale Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Nasturtium officinale Apocytochrome f (petA) and its basic structure?

Nasturtium officinale Apocytochrome f is a protein encoded by the petA gene in watercress (Nasturtium officinale). The recombinant form is produced for research purposes with expression typically occurring in the 36-320 region. The protein contains a specific amino acid sequence that includes:

YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPDKKNILVIGPVPGQKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF

This protein belongs to the cytochrome family and plays a crucial role in electron transport during photosynthesis. Understanding its structure is essential for photosynthesis research and comparative plant biology studies. The functional protein participates in the electron transport chain within plant chloroplasts, serving as an essential component in energy production pathways.

How does the recombinant form differ from native Apocytochrome f?

The recombinant Nasturtium officinale Apocytochrome f is produced through molecular cloning techniques rather than direct extraction from plant material. This provides several research advantages:

  • Enhanced purity (>95% typical for recombinant proteins)

  • Consistent protein structure across batches

  • Absence of plant-derived contaminants

  • Potential for tag incorporation for detection and purification

  • Expression region optimization (36-320 in this case)

While the amino acid sequence matches the natural protein, recombinant production allows for controlled modifications that can facilitate experimental applications. The recombinant form may include affinity tags determined during the production process, which should be considered when designing experiments that might be affected by these modifications.

What are the primary research applications for Recombinant Nasturtium officinale Apocytochrome f?

Recombinant Nasturtium officinale Apocytochrome f serves multiple research functions:

  • Photosynthesis mechanism studies: Investigating electron transport chain dynamics in chloroplasts

  • Structural biology research: Examining protein-protein interactions within photosystem complexes

  • Comparative plant biology: Contrasting photosynthetic efficiency across species

  • Antibody development: Creating detection tools for native protein quantification

  • Electron transport reconstitution experiments: Reconstructing photosystem components in vitro

When designing experiments, researchers should consider the potential interactions between this protein and other components in the photosynthetic machinery. The protein can be used in immunohistochemistry, protein-protein interaction studies, and functional reconstitution of electron transport chains.

How can Recombinant Nasturtium officinale Apocytochrome f be incorporated into advanced photosynthesis research models?

For advanced photosynthesis research, this recombinant protein enables several sophisticated experimental approaches:

  • Reconstitution experiments: Combining purified components to recreate electron transport

  • Site-directed mutagenesis studies: Exploring functional domains by introducing specific mutations

  • Electron transfer kinetics: Measuring energy transfer rates between photosystem components

  • Protein-protein interaction mapping: Identifying binding partners and interaction surfaces

  • Structural analysis: Contributing to cryo-EM or crystallography studies of photosystem architecture

When incorporating this protein into research models, it's essential to consider physiologically relevant concentrations and maintain appropriate redox conditions that mimic the chloroplast environment. The presence of potential tags should be evaluated for their impact on protein function in these complex systems.

What are the optimal storage conditions for maintaining Recombinant Nasturtium officinale Apocytochrome f activity?

To preserve functional integrity, follow these evidence-based storage guidelines:

  • Primary storage: Maintain at -20°C for routine research usage

  • Long-term archiving: Store at -80°C to minimize degradation

  • Working solution preparation: Aliquot into single-use volumes before freezing

  • Storage buffer composition: Typically provided in Tris-based buffer with 50% glycerol

  • Freeze-thaw cycles: Limit to absolute minimum; repeated freezing and thawing significantly reduces activity

  • Working aliquots: Can be stored at 4°C for up to one week

This storage protocol maximizes protein stability while preventing degradation from proteases and oxidation. The high glycerol concentration (50%) helps prevent damaging ice crystal formation during freezing cycles.

What analytical techniques are most effective for studying Apocytochrome f functional properties?

Multiple analytical approaches can be employed to characterize this protein's properties:

TechniqueApplicationKey ParametersAdvantages
Circular DichroismSecondary structure analysis190-260 nm wavelength scanQuickly detects structural integrity
UV-Vis SpectroscopyRedox state monitoringAbsorbance at 550-555 nmSimple, non-destructive analysis
FRET AnalysisProtein-protein interactionsDonor/acceptor fluorophore pairsMeasures dynamic interactions
Electron Paramagnetic ResonanceElectron transfer kineticsg-factor, hyperfine couplingDirect observation of unpaired electrons
Mass SpectrometryPost-translational modificationsMass accuracy <5 ppmIdentifies subtle protein modifications

When applying these techniques, researchers should incorporate appropriate controls and standards to ensure reliable data interpretation. The choice of technique should align with the specific research question being addressed.

How does Nasturtium officinale Apocytochrome f compare with homologous proteins from other plant species?

Apocytochrome f shows evolutionary conservation across plant species with several notable characteristics:

  • Sequence homology: Typically 80-95% sequence identity among flowering plants

  • Functional domains: Highly conserved heme-binding regions and electron transfer domains

  • Species-specific variations: Minor differences in surface-exposed residues

  • Structural stability: Generally more conserved in C-terminus than N-terminus regions

  • Molecular weight: Usually between 30-35 kDa across species

When conducting comparative studies, researchers should consider these evolutionary patterns while analyzing functional differences that may relate to photosynthetic efficiency variation between species. The high conservation of this protein reflects its fundamental importance in plant photosynthesis.

What is the relationship between Nasturtium officinale phytochemical profiles and Apocytochrome f expression?

Watercress (Nasturtium officinale) contains several bioactive compounds that may influence or correlate with Apocytochrome f expression:

  • Glucosinolates: Particularly gluconasturtiin (640.94 mg/100g DW in plant herbs), which may serve as stress response signals affecting chloroplast protein expression

  • 4-Methoxyglucobrassicin: Present at 23.47 mg/100g DW in herb extracts, potentially involved in redox signaling pathways

  • Phenolics and flavonoids: Including rutoside (7.20 mg/100g DW), which exhibit antioxidant properties that may protect chloroplast components

  • Antioxidant systems: Potentially regulating oxidative damage to photosynthetic machinery

The relationship between these phytochemicals and Apocytochrome f expression represents an emerging research area. Environmental stressors that alter phytochemical profiles may correspondingly affect photosynthetic protein expression patterns, presenting opportunities for integrated metabolomic and proteomic studies.

How can Recombinant Nasturtium officinale Apocytochrome f be utilized in electron transport chain reconstitution studies?

Electron transport chain reconstitution provides valuable insights into photosynthetic mechanisms:

  • Protein components: Combine Apocytochrome f with other purified components (plastocyanin, photosystem I proteins)

  • Membrane systems: Incorporate proteins into liposomes or nanodiscs to mimic thylakoid environment

  • Electron donors/acceptors: Use artificial electron donors like ascorbate and acceptors like methyl viologen

  • Spectroscopic monitoring: Track electron flow through absorbance changes at characteristic wavelengths

  • Kinetic analysis: Measure electron transfer rates under various conditions

When developing these experimental systems, researchers should carefully consider protein:lipid ratios, buffer composition (particularly pH and ionic strength), and the presence of cofactors required for optimal activity. The integrity of the reconstituted system can be verified through functional assays measuring electron transfer rates.

What methodological approaches can resolve data inconsistencies in Apocytochrome f functional studies?

Addressing experimental inconsistencies requires systematic troubleshooting:

  • Protein quality assessment: Verify structural integrity via circular dichroism or thermal shift assays

  • Cofactor analysis: Ensure appropriate heme incorporation through absorption spectroscopy

  • Redox state standardization: Control protein oxidation state before experiments

  • Environmental variables: Systematically test effects of pH, temperature, and ionic strength

  • Interaction partners: Verify the quality of other proteins in reconstitution systems

A methodical approach to identifying variables causing inconsistent results involves designing factorial experiments that systematically modify one parameter while holding others constant. Statistical tools like principal component analysis can help identify which experimental factors contribute most significantly to variability in results.

How might Nasturtium officinale environmental adaptations affect Apocytochrome f structure and function?

Watercress (Nasturtium officinale) naturally grows in flowing spring water at consistent temperatures around 12°C , which may influence its photosynthetic protein adaptations:

  • Temperature stability: Potential adaptations for function at lower temperatures compared to terrestrial plants

  • Light exposure modifications: Possible structural adjustments for photosynthesis in partially shaded aquatic environments

  • Water-interface adaptations: Potential protein modifications to function optimally in high-humidity environments

  • Seasonal expression patterns: Possible regulatory mechanisms to adjust photosynthetic efficiency with seasonal changes

  • Stress response elements: Potential structural features conferring resistance to waterborne pathogens

Researchers studying the environmental adaptations of this protein should consider designing experiments that compare functionality across temperature ranges, light intensities, and other environmental variables relevant to the aquatic habitat of watercress.

What are the emerging applications of Apocytochrome f research in biotechnology and synthetic biology?

Emerging applications represent exciting frontiers for this research:

  • Synthetic photosystems: Engineering optimized electron transport components for artificial photosynthesis

  • Biofuel development: Creating enhanced photosynthetic efficiency for improved biomass production

  • Biosensor applications: Utilizing redox-sensitive properties for environmental monitoring devices

  • Climate change adaptation: Understanding photosynthetic protein adaptations to temperature fluctuations

  • Crop improvement: Transferring beneficial variants to agricultural species

These applications require interdisciplinary approaches combining structural biology, molecular engineering, and plant physiology. Researchers entering this field should consider collaborations that bridge traditional disciplinary boundaries to address complex challenges in sustainable energy and agriculture.

What are the current limitations in Apocytochrome f research and emerging solutions?

Several challenges persist in this research area:

  • Membrane protein crystallization: Difficulties obtaining high-resolution structures

    • Emerging solution: Cryo-EM techniques for membrane protein structural analysis

  • In vivo functional assessment: Challenges studying the protein in its native environment

    • Emerging solution: Advanced fluorescent tagging methods with minimal functional disruption

  • Species variation interpretation: Difficulty correlating sequence differences with functional changes

    • Emerging solution: Machine learning approaches to predict functional impacts of sequence variations

  • Dynamic interaction mapping: Challenges capturing transient protein-protein interactions

    • Emerging solution: Time-resolved crosslinking mass spectrometry techniques

  • Physiological relevance: Bridging in vitro findings with in vivo significance

    • Emerging solution: Advanced plant transformation systems for variant testing in native systems

These limitations highlight opportunities for methodological innovation. Researchers should stay informed about technical developments in related fields that might be adapted to address these specific challenges.

How might integrated multi-omics approaches enhance understanding of Apocytochrome f in plant systems?

Integrative approaches offer comprehensive insights:

  • Genomics + Proteomics: Correlating genetic variations with protein expression levels and modifications

  • Transcriptomics + Metabolomics: Linking gene expression changes with metabolite profiles under various conditions

  • Structural Biology + Interactomics: Mapping physical interactions onto three-dimensional structures

  • Phenomics + Functional Proteomics: Connecting plant phenotypes with protein functional states

  • Environmental Monitoring + Systems Biology: Modeling protein responses to environmental variables

This integrated approach requires sophisticated data integration techniques and appropriate normalization methods across different data types. Researchers should develop computational pipelines specifically designed to identify correlations between these multiple data dimensions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.