Recombinant Nasturtium officinale ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

AlphaFold Prediction Model

A computational structure model of the protein is available in the RCSB Protein Data Bank under the identifier AF_AFA4QLS1F1. This model was generated using AlphaFold, a powerful AI-based protein structure prediction tool. The model was initially released in the AlphaFold Database on December 9, 2021, with the latest modification on September 30, 2022 .

The model confidence metrics reveal important information about the reliability of the predicted structure:

Confidence MetricValueInterpretation
pLDDT (global)59.53Low confidence

Biological Function and Role in Photosynthesis

ATP synthase subunit a, chloroplastic (atpI) is a critical component of the chloroplast ATP synthase complex, which plays a fundamental role in the energy generation process of photosynthetic organisms.

Role in ATP Synthesis

Within the chloroplast, ATP synthase functions as a molecular motor that harnesses the energy from proton gradients established during photosynthesis to synthesize ATP, the primary energy currency of cells. The subunit a (atpI) specifically contributes to the formation of the proton channel within the membrane-embedded portion (F0 sector) of the ATP synthase complex .

The protein is embedded in the thylakoid membrane of chloroplasts, where it works in concert with other subunits to facilitate the flow of protons across the membrane. This proton movement drives the rotary mechanism of ATP synthase, ultimately leading to the phosphorylation of ADP to form ATP .

Evolutionary Conservation

The atpI gene is part of the chloroplast genome (plastome) in Nasturtium officinale, highlighting its fundamental importance in photosynthetic function. Plastomes typically encode core proteins of photosynthetic complexes, including Photosystem I, Photosystem II, Cytochrome b6f, NADH dehydrogenase, ATP synthase, and the large subunit of RUBISCO, as well as tRNAs and ribosomal RNAs necessary for chloroplast translation .

Research on related species in the Brassicaceae family reveals that while genic regions are generally conserved across the plastomes of higher plants, variations can occur that might affect protein function and evolutionary adaptation .

Genomic Context and Plastome Organization

The atpI gene is located within the chloroplast genome of Nasturtium officinale. Understanding its genomic context provides valuable insights into its evolution and functional significance.

Chloroplast Genome Structure

The chloroplast genome of plants typically displays a quadripartite organization characterized by:

  1. Large Single Copy (LSC) region

  2. Small Single Copy (SSC) region

  3. Two Inverted Repeat regions (IR A and IR B)

Research on related Brassicaceae species, which used Nasturtium officinale as a reference, provides insights into the likely organization of the Nasturtium chloroplast genome. For instance, in Cardamine species, the plastome contains approximately 85 protein-coding genes, 37 tRNAs, and 8 rRNAs .

FeatureTypical Characteristics in Brassicaceae
Total plastome length~155,000 bp
GC content~36.3% (AT-rich)
Inverted Repeat length~26,500 bp
LSC region length~84,000 bp
SSC region length~18,000 bp

The atpI gene is likely located within one of these regions, contributing to the ATP synthase complex essential for photosynthetic energy production .

Product Offerings

The protein is available as:

  1. Purified recombinant protein with His-tag

  2. Components of ELISA kits for specific detection

Commercial products typically provide the protein in a stabilized form, often lyophilized and with specific recommendations for reconstitution and storage .

Research Applications

The recombinant protein has several potential applications in research:

  1. Generation of specific antibodies against the protein

  2. Studies of protein-protein interactions within the ATP synthase complex

  3. Structural biology investigations

  4. Evolutionary studies of chloroplast proteins

  5. Investigation of photosynthetic efficiency in different conditions

These applications contribute to our understanding of photosynthesis, chloroplast evolution, and potential biotechnological applications related to energy production and plant productivity .

Reconstitution Protocol

For lyophilized protein preparations, the following reconstitution procedure is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  4. Aliquot for long-term storage at -20°C/-80°C

This protocol helps maintain protein stability and prevents unnecessary degradation during experimental procedures .

Future Research Directions

Despite the current knowledge about Nasturtium officinale ATP synthase subunit a, chloroplastic (atpI), several avenues for future research remain open:

Functional Studies

Investigation of how variations in the atpI sequence among different species might affect ATP synthase efficiency and plant fitness could provide valuable insights into evolutionary adaptations related to photosynthetic efficiency .

Biotechnological Applications

Exploring potential biotechnological applications, such as enhancing photosynthetic efficiency or energy production in artificial systems, represents an exciting frontier for research involving this protein.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Nasturtium officinale (Water-cress) (Rorippa nasturtium-aquaticum)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVLAI RNPQTIPTDGQNFFEFVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWK IIQLPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILE DFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAY IGESMEGHH
Uniprot No.

Target Background

Function
This protein serves as a crucial component of the proton channel, playing a direct role in facilitating the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Nasturtium officinale ATP synthase subunit a and its role in chloroplasts?

ATP synthase subunit a (atpI) from Nasturtium officinale (watercress) is a critical component of the chloroplastic ATP synthase complex. This protein is encoded by the atpI gene and functions as part of the F0 sector of the ATP synthase machinery, which is responsible for proton translocation across the thylakoid membrane . The full-length protein consists of 249 amino acids and includes several transmembrane domains that form an essential part of the proton channel . The amino acid sequence reveals a highly hydrophobic protein with multiple membrane-spanning regions, consistent with its role in the membrane-embedded F0 portion of ATP synthase. AtpI participates in converting the proton gradient established during photosynthesis into mechanical energy that drives ATP synthesis in the F1 portion of the complex. This process is fundamental to energy production in photosynthetic organisms, making atpI an important subject for research in plant bioenergetics and chloroplast function.

How does chloroplastic ATP synthase subunit a differ structurally from mitochondrial counterparts?

Chloroplastic ATP synthase subunit a (atpI) differs from its mitochondrial counterparts in several key structural aspects, reflecting their evolutionary divergence and adaptation to different organellar environments. The chloroplastic atpI features specific transmembrane domains optimized for function within the thylakoid membrane environment, which has a different lipid composition and pH gradient compared to the inner mitochondrial membrane . Sequence analysis reveals that Nasturtium officinale atpI contains unique motifs, including specialized regions for interaction with other ATP synthase subunits specific to chloroplasts. The amino acid sequence "MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVLAI RNPQTIPTDGQNFFEFVLEFIRDVSKTQIGEEYGPWVP..." indicates specific functional domains that distinguish it from mitochondrial homologs . While both chloroplastic and mitochondrial ATP synthases share the basic rotary mechanism coupling proton translocation to ATP synthesis, the subunit composition and specific interactions within the complex have evolved differently, reflecting the distinct evolutionary origins of these organelles and their specialized functions in energy metabolism.

What purification challenges are specific to recombinant chloroplastic membrane proteins?

Purification of recombinant Nasturtium officinale atpI presents several challenges inherent to chloroplastic membrane proteins. The highly hydrophobic nature of atpI, with multiple transmembrane domains, makes it difficult to maintain protein solubility during extraction and purification processes . Researchers often encounter protein aggregation, misfolding, and loss of native conformation when attempting to isolate this protein. Standard purification approaches for soluble proteins typically yield poor results with membrane proteins like atpI, necessitating specialized techniques. The use of histidine tags (as in the commercially available recombinant protein) can aid purification through metal affinity chromatography, but care must be taken to ensure the tag doesn't interfere with protein structure or function . Additionally, the choice of detergents is critical for membrane protein purification; too harsh detergents may denature the protein, while insufficient detergent may fail to solubilize it from membranes. Researchers should implement a multi-step purification protocol that may include initial extraction with mild detergents like n-dodecyl-β-D-maltoside, followed by affinity chromatography and size exclusion techniques to obtain pure, functional protein suitable for downstream analyses.

How do mutations in conserved domains of atpI affect ATP hydrolysis activity?

Mutations in conserved domains of Nasturtium officinale atpI can significantly alter ATP hydrolysis activity, providing insights into structure-function relationships within this protein. Research on related chloroplastic proteins suggests that modifications to the transmembrane regions involved in proton translocation can drastically impact both ATP synthesis and hydrolysis capabilities . When investigating these effects, researchers should employ site-directed mutagenesis targeting highly conserved residues, particularly those within predicted proton channels or at subunit interfaces. The altered proteins can then be assessed using in vitro ATP hydrolysis assays similar to those described for other chloroplastic proteins, where time-dependent increases in ADP and inorganic phosphate (Pi) are measured through HPLC or other analytical techniques . Studies on related systems have demonstrated that specific mutations can alter the Km and Vmax values for ATP hydrolysis, providing quantitative measurements of catalytic efficiency. For example, research on AtVIPP1 showed that alterations in key domains changed ATP hydrolysis kinetics, with Km values shifting from 1.07 mM to 0.22 mM under different pH conditions . When designing such experiments with atpI, researchers should consider creating a panel of mutants affecting different functional domains to comprehensively map the relationship between protein structure and hydrolytic function.

How does pH dependence of ATP hydrolysis activity differ between recombinant atpI and native protein complexes?

The pH dependence of ATP hydrolysis activity exhibits significant differences between isolated recombinant atpI and the native protein functioning within complete ATP synthase complexes. Research on related chloroplastic proteins has demonstrated that pH optimality can shift dramatically when comparing isolated subunits to intact complexes . When investigating this phenomenon with Nasturtium officinale atpI, researchers should employ systematic activity assays across a range of pH values (typically pH 6.5-8.5) for both the recombinant protein and native complexes extracted from chloroplasts. Studies on similar systems have shown that activity can vary by more than 50% between different pH conditions, with some proteins showing optimal activity at alkaline pH values around 8.5 . These differences likely reflect the natural environment of the chloroplast, where light-induced pH changes affect enzyme function. The kinetic parameters (Km and Vmax) should be determined at multiple pH values to generate a complete profile of pH dependence. For example, research on AtVIPP1 revealed that at pH 7.5, Km and Vmax were 1.07 mM and 0.39 μM Pi release/μg protein/min, respectively, while at pH 8.5, these values shifted to 0.22 mM and 0.35 μM Pi release/μg protein/min, indicating significantly higher affinity for ATP under more alkaline conditions . Such analyses can provide insights into how the local environment influences atpI function and how isolation affects the protein's catalytic properties.

What are the optimal conditions for measuring ATP hydrolysis activity of recombinant atpI?

Measuring ATP hydrolysis activity of recombinant Nasturtium officinale atpI requires carefully optimized conditions to ensure reliable and reproducible results. Based on studies with similar chloroplastic proteins, researchers should consider using a basic reaction buffer containing 50-100 mM Tris-HCl (pH 7.5-8.5), supplemented with divalent cations such as Mg²⁺ or Ca²⁺ at concentrations between 1-5 mM . The choice between these cations is significant, as they can differentially affect enzyme kinetics; research on related proteins shows that Ca²⁺ can provide higher substrate affinity compared to Mg²⁺ under certain pH conditions. ATP should be provided at concentrations ranging from 0.1-5 mM to enable proper kinetic analyses, with temperature maintained at 25-30°C to reflect physiological conditions in plants. Activity measurements should be conducted using either a coupled enzyme assay system (linking ATP hydrolysis to NADH oxidation for spectrophotometric detection) or direct measurement of released inorganic phosphate through colorimetric methods such as malachite green assay. Alternatively, HPLC analysis can provide precise quantification of both ADP and Pi production over time, as demonstrated in studies of similar proteins where time-dependent increases in reaction products were monitored to calculate enzymatic rates . When establishing these conditions, researchers should systematically vary each parameter while maintaining others constant to determine the optimal combination for maximal activity detection.

What techniques are most effective for studying atpI interactions with other ATP synthase subunits?

For studying interactions between Nasturtium officinale atpI and other ATP synthase subunits, researchers should employ a complementary set of techniques that address both physical associations and functional consequences of these interactions. Co-immunoprecipitation using antibodies against atpI or other subunits can identify direct binding partners in native or reconstituted systems. For more detailed binding kinetics, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide quantitative measurements of interaction affinities and thermodynamics. Studies on related systems have demonstrated successful use of fluorescence-based methods to measure binding coefficients; for example, intrinsic tryptophan fluorescence has been used to monitor conformational changes upon binding between ATP synthase components, with dissociation constants (Kd) as low as 1.4 nM for tightly associated subunits . For visualizing the structural basis of interactions, cryo-electron microscopy has proven valuable for resolving ATP synthase complexes, particularly when complemented with cross-linking mass spectrometry to identify specific contact points between subunits. Additionally, yeast two-hybrid or bacterial two-hybrid systems can be adapted for membrane proteins to screen for interaction partners. When designing these experiments, researchers should consider that the stator stalk components must withstand elastic strain during subunit rotation, making the strength and nature of these interactions particularly important for understanding ATP synthase function .

How can researchers effectively design experiments to compare recombinant atpI with native protein?

Designing experiments to compare recombinant Nasturtium officinale atpI with its native counterpart requires careful consideration of multiple factors to ensure valid comparisons. Researchers should begin by establishing parallel purification protocols that minimize procedural differences while accounting for the distinct starting materials. For the recombinant protein, expression systems should be optimized to ensure proper folding and post-translational modifications, preferably using eukaryotic expression systems that better mimic the native environment . The native protein should be extracted using gentle solubilization methods that maintain the integrity of protein complexes. When comparing functional properties, identical assay conditions should be employed for both protein sources, with activity measurements conducted simultaneously to eliminate day-to-day variations. Structural comparisons can include circular dichroism spectroscopy to assess secondary structure content, thermal stability assays to compare folding robustness, and limited proteolysis to probe conformational differences. Mass spectrometry analysis can identify any post-translational modifications present in the native but absent in the recombinant protein. For functional studies, researchers should measure not only ATP hydrolysis rates but also proton translocation capabilities using reconstituted liposome systems. Additionally, protein-protein interaction studies should compare the ability of both protein forms to associate with other ATP synthase subunits, which can reveal differences in complex assembly potential. Throughout these comparative analyses, statistical methods such as paired t-tests or ANOVA should be employed to determine the significance of any observed differences .

What controls are essential when studying recombinant atpI activity and interactions?

When studying recombinant Nasturtium officinale atpI activity and interactions, implementing rigorous controls is essential for generating reliable and interpretable data. For activity assays, researchers must include enzyme-free controls to account for spontaneous ATP hydrolysis, which can occur at appreciable rates under certain buffer conditions. Additionally, heat-denatured protein controls are crucial to distinguish enzymatic activity from potential contaminants in the protein preparation. When specific inhibitors of ATP synthase are used (such as oligomycin), control experiments with known ATP hydrolases (like apyrase) can confirm inhibitor specificity . For interaction studies, non-specific binding controls using irrelevant proteins of similar size and charge characteristics should be employed alongside specific competitors that can disrupt genuine interactions. When using tagged recombinant proteins, controls with the tag alone or with the tag on an irrelevant protein are essential to rule out tag-mediated artifacts. For functional reconstitution experiments, liposomes without incorporated protein serve as critical controls for background leakage or non-specific effects. Statistical validation requires multiple independent protein preparations and technical replicates, with appropriate statistical tests applied to determine significance . When studying pH-dependent effects, buffer controls that maintain identical ionic strength across different pH values are necessary to distinguish pH effects from ionic strength influences. These comprehensive controls collectively ensure that observed activities and interactions can be confidently attributed to the biological properties of atpI rather than experimental artifacts.

How should researchers approach liposome reconstitution experiments with atpI?

Liposome reconstitution with Nasturtium officinale atpI requires careful consideration of lipid composition, protein-to-lipid ratios, and reconstitution methods to effectively mimic the native chloroplast membrane environment. Researchers should select lipid mixtures that approximate the thylakoid membrane composition, typically including phosphatidylcholine, phosphatidylglycerol, and monogalactosyldiacylglycerol in appropriate ratios. The reconstitution process typically begins with lipid mixture preparation in chloroform, followed by solvent evaporation under nitrogen to form a thin film, which is then hydrated in buffer to form multilamellar vesicles. These vesicles should be processed through freeze-thaw cycles and extrusion through polycarbonate membranes to create unilamellar liposomes of defined size (typically 100-200 nm). For protein incorporation, detergent-mediated reconstitution is commonly employed, where purified atpI in detergent solution is mixed with preformed liposomes, followed by detergent removal using bio-beads or dialysis . The protein-to-lipid ratio should be optimized, typically starting with ratios between 1:50 and 1:200 (w/w). Successful reconstitution can be verified through density gradient centrifugation, which separates protein-containing liposomes from empty vesicles. Functional assessment of reconstituted atpI should include proton translocation assays using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine, combined with ATP hydrolysis measurements to correlate these activities. Cryo-electron microscopy can provide structural verification of proper protein incorporation and orientation within the bilayer.

What experimental approaches can distinguish between ATP synthase and ATP hydrolase activities?

Distinguishing between ATP synthase and ATP hydrolase activities of Nasturtium officinale atpI requires specialized experimental approaches that can separate these mechanistically related but functionally distinct processes. Researchers should implement bidirectional assays that can measure both ATP synthesis and hydrolysis under controlled conditions. For ATP synthesis measurements, reconstituted proteoliposomes containing atpI and other essential ATP synthase subunits should be energized with an artificial proton gradient, typically established using pH jump methods or valinomycin-induced potassium diffusion potentials . The resulting ATP production can be quantified using luciferase-based luminescence assays or coupled enzyme systems. Conversely, ATP hydrolysis can be measured through phosphate release assays or HPLC-based methods tracking ADP formation, as demonstrated in studies of similar proteins where time-dependent increases in both ADP and Pi were monitored . To definitively separate these activities, researchers should employ specific inhibitors that differentially affect synthesis versus hydrolysis, such as aurovertin or efrapeptin. Additionally, manipulating the experimental conditions can bias the reaction in either direction – high ATP concentrations favor hydrolysis, while high ADP and Pi with an established proton gradient favor synthesis. The directionality of ATP synthase/hydrolase activity is also influenced by pH and membrane potential, providing additional experimental variables for distinguishing these activities. Measurement of H⁺/ATP ratios under different conditions can further characterize the coupling efficiency between proton translocation and ATP conversion in either direction.

How should researchers analyze kinetic data from atpI activity assays?

Analyzing kinetic data from Nasturtium officinale atpI activity assays requires rigorous mathematical treatment to extract meaningful parameters that characterize the enzyme's catalytic properties. Initial velocity data obtained across varying substrate concentrations should be fitted to appropriate enzyme kinetic models using non-linear regression analysis. For simple Michaelis-Menten kinetics, researchers should determine Km and Vmax values, which provide insights into substrate affinity and maximum reaction rate, respectively . When analyzing ATP hydrolysis data specifically, time course experiments should track the formation of both ADP and inorganic phosphate (Pi) to confirm equimolar production, as demonstrated in studies of similar chloroplastic proteins where HPLC analysis was used to quantify these reaction products over time . For complex kinetic behaviors like substrate inhibition, which has been observed in similar systems at high ATP concentrations, modified equations incorporating inhibition constants should be employed. When examining the effects of pH or divalent cations on activity, researchers should generate complete pH-rate profiles and determine apparent pKa values for ionizable groups involved in catalysis. Studies on similar proteins have shown dramatic shifts in kinetic parameters under different conditions; for instance, changing from Mg²⁺ to Ca²⁺ at pH 8.5 altered the Km from 1.07 mM to 0.22 mM, indicating substantially higher substrate affinity . Statistical validation through replicate experiments is essential, with parameters reported as mean values with standard errors. For more complex analyses, global fitting of multiple datasets can provide more robust parameter estimates by simultaneously analyzing data from various experimental conditions.

What approaches help resolve contradictions in experimental data from different atpI preparation methods?

Resolving contradictions in experimental data from different Nasturtium officinale atpI preparation methods requires systematic investigation of factors that might influence protein structure and function. Researchers should first verify protein integrity across preparations using SDS-PAGE, mass spectrometry, and N-terminal sequencing to ensure that the primary structure remains consistent . Western blotting with specific antibodies can confirm identity and detect potential degradation products. When functional discrepancies arise, researchers should compare protein secondary and tertiary structure using circular dichroism spectroscopy, fluorescence spectroscopy, and limited proteolysis to identify conformational differences that might explain divergent activities. Careful examination of buffer compositions is essential, as even minor differences in pH, ionic strength, or presence of specific ions can dramatically alter enzyme behavior . Additionally, researchers should evaluate protein oligomerization states across preparations using size exclusion chromatography or analytical ultracentrifugation, as changes in quaternary structure can significantly impact function. The presence and nature of detergents used during purification deserve particular attention, as they can differentially affect membrane protein activity. To systematically address contradictions, researchers should design convergence experiments where variables between preparation methods are sequentially eliminated until consistent results are obtained. Statistical meta-analysis of data from multiple preparation methods can help identify systematic biases and determine which factors most strongly influence experimental outcomes . When contradictions persist despite these approaches, complementary techniques measuring different aspects of the same activity can provide additional insights into the source of discrepancies.

How can structural bioinformatics enhance functional studies of atpI?

Structural bioinformatics approaches can significantly enhance functional studies of Nasturtium officinale atpI by providing predictions about protein structure, functional domains, and evolutionary relationships that inform experimental design and data interpretation. Researchers should begin with comprehensive sequence analysis using tools like BLAST, HMMER, and multiple sequence alignment to identify conserved domains and critical residues across related ATP synthase subunits from different species . Hydropathy plot analysis can predict transmembrane segments, which is particularly valuable for membrane proteins like atpI that are challenging to characterize structurally through traditional experimental methods. Homology modeling based on structures of related proteins can generate three-dimensional models that, while not as precise as experimental structures, can provide valuable insights into potential mechanisms and guide site-directed mutagenesis experiments. Molecular dynamics simulations can predict how atpI might interact with lipid bilayers and other ATP synthase subunits, generating testable hypotheses about critical interaction interfaces . Evolutionary coupling analysis can identify co-evolving residues that likely form contacts either within atpI or between atpI and other subunits. When experimental structural data are available for portions of the protein, tools like Rosetta can help build complete structural models incorporating these constraints. Network analysis of protein-protein interactions can place atpI within the broader context of chloroplast protein complexes, suggesting potential functional relationships beyond the core ATP synthase complex. These computational approaches should be integrated with experimental data in an iterative process, where bioinformatic predictions guide experiments, and experimental results refine computational models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.