Recombinant Nasturtium officinale Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Overview of Chloroplast Envelope Membranes

Chloroplasts, essential organelles in plant cells, are delineated by two envelope membranes that host a complex biochemical machinery . These membranes are critical for chloroplast development and integrating chloroplast function within the plant cell . Proteomic analysis has identified many proteins within these membranes, contributing to our understanding of chloroplast envelope metabolism at the molecular level .

Proteomic Analysis of Chloroplast Envelope Membranes

Proteomics is vital for a comprehensive view of the protein composition of chloroplast envelope membranes . Sample preparation involves isolating highly purified envelope membranes and extracting proteins using methods that capture a wide range of hydrophobicities . Liquid chromatography-tandem mass spectrometry is then used to identify proteins within each membrane subfraction . Proteomic studies have identified over 100 proteins in Arabidopsis chloroplasts, with approximately 80% known or likely located in the chloroplast envelope . These proteins are involved in:

  • Ion and metabolite transport

  • Protein import machinery

  • Chloroplast lipid metabolism

Some soluble proteins, such as proteases and those involved in carbon metabolism or oxidative stress responses, have also been found associated with envelope membranes .

Dynamics and Remodeling of Plastid Envelope Membranes

Live cell imaging is a useful approach for distinguishing the localization of proteins within the two envelope membranes . Overexpression of envelope membrane proteins can induce membrane proliferation in distinct patterns, offering a tool to assess the localization of unknown proteins . Studies have shown that the inner and outer envelope membranes are affected differently by protein overexpression, suggesting different regulatory mechanisms control their structures .

Case Studies and Experimental Findings

  • AtTOC64-GFP Expression: Expressing AtTOC64-GFP (a protein likely located in the outer envelope membrane) results in circular GFP fluorescence surrounding chlorophyll autofluorescence . Over time, labeled loop-like deformations and thin tubular structures evolve, connecting different chloroplasts .

  • AtLACS9 Localization: The protein AtLACS9 was localized to the chloroplast outer envelope and found to label stromules, which are tubules extending from the chloroplast .

  • Inner Envelope Protein Expression: Overexpression of inner envelope proteins like AtTPT, AtAPG1, and AtLrgB leads to similar patterns: punctate structures around the chloroplast, crescent moon structures, and out loops . This suggests membrane deformations result from increased protein amounts rather than the specific function or biochemical properties of the proteins .

Tables of Identified Proteins and Functions

Because there is no precise data about Recombinant Nasturtium officinale Chloroplast envelope membrane protein (cemA), the tables presented are related to the proteins found during experiments, as well as their respective functions.

ProteinFunction
Phosphate TransportersTransport of phosphate across the envelope membrane
TIC/TOC componentsProtein import into chloroplasts
AtLACS9Fatty acid import
AtTPTTriosephosphate carrier in the inner envelope membrane
AtAPG1Methylation of demethylplastoquinol to plastoquinone-9
AtLrgBUnknown molecular function, highly abundant in the inner envelope membrane

Implications for Chloroplast Biotechnology

Understanding the dynamics and protein composition of chloroplast envelope membranes is crucial for advancing chloroplast biotechnology . Manipulating protein transport, membrane structure, and protein localization can enhance various applications, such as:

  • Metabolic Engineering: Modifying metabolic pathways within chloroplasts to produce valuable compounds .

  • Stress Tolerance: Enhancing plant resilience to environmental stresses by altering envelope membrane composition and function .

  • Nanotechnology: Using chloroplasts as platforms for producing nanomaterials .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Nasturtium officinale (Water-cress) (Rorippa nasturtium-aquaticum)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKTWITNWWNTRQCETFLNDIQEKSVLEKF IQLEDLFQLDEMIKEYTETDLQQFRLGIHKETIQFIKIHNEYRIHTILHFSTNLISFVIL SGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of cemA protein in Nasturtium officinale?

CemA (Chloroplast envelope membrane protein) is a 229-amino acid membrane protein encoded by the chloroplast genome of Nasturtium officinale. The full amino acid sequence (MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKTWITNWWNTRQCETFLNDIQEKSVLEKFIQLEDLFQLDEMIKEYTETDLQQFRLGIHKETIQFIKIHNEYRIHTILHFSTNLISFVILSGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKDFGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND) reveals a hydrophobic protein with transmembrane domains that likely functions in the chloroplast envelope membrane . The protein plays roles in CO₂ uptake and potentially in photosynthetic efficiency, though specific functions in Nasturtium may differ from those in other plant species. Comparative analysis with cemA from other Brassicaceae family members would help elucidate conservation of functional domains.

What are the challenges in isolating native cemA protein compared to using recombinant expression systems?

Isolating native cemA protein from Nasturtium officinale presents significant challenges including: (1) Low abundance in natural tissues, requiring processing of large amounts of plant material; (2) Membrane protein characteristics making it difficult to solubilize while maintaining structure; (3) Risk of co-purifying other chloroplast proteins; and (4) Potential degradation during extraction. In contrast, recombinant expression systems allow for controlled production with affinity tags for easier purification . Bacterial expression systems may struggle with proper folding of eukaryotic membrane proteins, while plant-based expression systems might better maintain native conformation but with lower yields. The choice between native isolation and recombinant expression depends on whether native post-translational modifications are critical to the research question.

What are the optimal expression systems for recombinant cemA protein production?

The optimal expression system for recombinant Nasturtium officinale cemA depends on research requirements. For structural studies requiring properly folded protein, eukaryotic systems like yeast (Pichia pastoris) or insect cells often provide better results for chloroplast membrane proteins than bacterial systems. For production of antibodies or when post-translational modifications are less critical, E. coli systems with specialized strains designed for membrane proteins (C41, C43) may be sufficient. The recombinant cemA protein described in the literature is produced with a tag system (though specific tag type is determined during production) . When expressing in E. coli, codon optimization is recommended, as chloroplast genes often have different codon usage than bacterial systems. Testing multiple constructs with varying N-terminal or C-terminal tags (His, GST, MBP) is advised to identify optimal folding and solubility conditions.

What purification strategies yield the highest purity cemA protein while maintaining structural integrity?

Purifying cemA protein requires specialized approaches for membrane proteins. A multi-step strategy is recommended: (1) Initial solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that preserve structural integrity; (2) Affinity chromatography utilizing the protein's expression tag (the tag type for cemA is determined during production) ; (3) Size exclusion chromatography to separate aggregates from properly folded protein; and (4) Ion exchange chromatography for final polishing. Throughout purification, maintaining a buffer containing 50% glycerol helps stabilize the protein as indicated in standard storage conditions . Monitoring protein quality at each step via circular dichroism spectroscopy can confirm that α-helical content expected for membrane proteins is maintained. For researchers needing large amounts of highly pure protein, considering commercial recombinant cemA (50 μg quantities are available) may be more efficient than establishing purification protocols .

How can researchers effectively validate the structural integrity of purified recombinant cemA protein?

Validating structural integrity of purified recombinant cemA protein requires multiple complementary approaches. Primary validation should include Western blotting using antibodies specific to cemA or to any affinity tags present. SDS-PAGE should show a single band at approximately the expected molecular weight. For secondary structure confirmation, circular dichroism spectroscopy can determine if the α-helical content matches predictions for this membrane protein. Tertiary structure can be assessed through limited proteolysis, which tests if the protein is properly folded by examining digestion patterns. Functional validation is essential - researchers should develop assays based on predicted cemA functions, potentially measuring interaction with other chloroplast components or assessing membrane integration using liposome incorporation experiments. Mass spectrometry should confirm the complete amino acid sequence matches expectations . Finally, protein stability testing under various pH and temperature conditions will determine if the recombinant protein behaves as expected for a membrane protein.

How can recombinant cemA protein be used to study photosynthetic efficiency in Nasturtium officinale?

Recombinant cemA protein can serve as a valuable tool for investigating photosynthetic efficiency in Nasturtium officinale through several experimental approaches. Researchers can develop antibodies against the purified recombinant cemA to track native protein levels and localization during different growth conditions and photosynthetic states. The protein can be reconstituted into liposomes with other chloroplast components to study its role in membrane transport processes related to photosynthesis. Protein-protein interaction studies using techniques like co-immunoprecipitation with the recombinant protein as bait can identify binding partners within the photosynthetic machinery. For functional studies, researchers can develop in vitro assays measuring CO₂ uptake or ion transport across membranes containing the recombinant protein. Additionally, the recombinant protein can be used in complementation studies with cemA-deficient mutants to confirm function. When designing these experiments, researchers should consider that optimal photosynthetic activity may require specific lipid environments and protein partners to maintain native conformation and function.

What techniques are most effective for studying cemA protein interactions with other chloroplast components?

For studying cemA protein interactions with other chloroplast components, researchers should employ multiple complementary techniques. Co-immunoprecipitation using antibodies against recombinant cemA can pull down interacting partners from chloroplast extracts, followed by mass spectrometry for identification. Yeast two-hybrid systems, specifically membrane-based variants like split-ubiquitin assays, are suitable for cemA as a membrane protein. For in vitro confirmation, microscale thermophoresis or surface plasmon resonance using the purified recombinant protein can quantify binding affinities. Proximity-based labeling techniques such as BioID, where cemA is fused to a biotin ligase, can identify proteins in close proximity within the native chloroplast environment. Fluorescence resonance energy transfer (FRET) using fluorescently-tagged cemA can visualize interactions in vivo. Crosslinking mass spectrometry is particularly valuable for mapping the precise contact sites between cemA and its interaction partners. When interpreting results, researchers should consider that the Tris-based buffer with 50% glycerol used for recombinant cemA storage may influence interaction dynamics and may need optimization for specific interaction studies.

How does cemA expression correlate with environmental stress responses in Nasturtium officinale?

While specific data on cemA expression under stress conditions in Nasturtium officinale is limited, researchers can design experiments to investigate this important relationship. Quantitative PCR and Western blot analyses using antibodies developed against recombinant cemA can track transcriptional and translational responses to various stressors including drought, salinity, temperature extremes, and heavy metal exposure. Studies should examine whether cemA expression patterns correlate with the known stress responses of Nasturtium officinale, particularly its ability to hyperaccumulate heavy metals like cadmium . Researchers should investigate potential connections between cemA functions and the plant's documented antioxidant activities (measurable via CUPRAC, FRAP, and DPPH assays) . The protein may play roles in maintaining photosynthetic efficiency under stress conditions. Comparative studies between normal growing conditions and Nasturtium plants exposed to cadmium-contaminated soil would be particularly relevant given the plant's phytoremediation applications . Characterizing cemA regulation could provide insights into how chloroplast membrane dynamics adapt to environmental challenges and possibly connect to the plant's medicinal properties.

How can cemA protein be used in biotechnological applications for improving plant stress tolerance?

Recombinant cemA protein enables several biotechnological approaches for enhancing plant stress tolerance. Researchers can develop transgenic plants with modified cemA expression to test effects on photosynthetic efficiency under stress conditions. If cemA shows protective functions during oxidative stress, its overexpression might enhance antioxidant capacity similar to Nasturtium's natural antioxidant properties measured by CUPRAC, FRAP, and DPPH assays (values of 4.45 mmol TE/g, 0.76 mmol TE/g, and 26.32% inhibition, respectively) . Structure-function studies with the recombinant protein can identify specific domains responsible for stress responses, potentially leading to engineered versions with enhanced protective capabilities. For applied biotechnology, cemA could be incorporated into artificial chloroplast membrane systems designed to maintain photosynthetic activity under adverse conditions. When developing these applications, researchers should consider that cemA manipulation might affect the production of important secondary metabolites like gluconasturtiin, which has significant antimicrobial properties . The biotechnological use of cemA should be evaluated in context with Nasturtium's established applications in phytoremediation, particularly for heavy metal contamination .

What roles might cemA play in the medicinal properties of Nasturtium officinale?

While no direct evidence links cemA protein to Nasturtium officinale's medicinal properties, several research hypotheses merit investigation. The protein could influence the biosynthesis pathways of bioactive compounds through its role in photosynthetic metabolism. Nasturtium's documented antimicrobial, antioxidant, and anti-inflammatory properties primarily derive from its secondary metabolites, particularly mustard seed oils and glucosinolates like gluconasturtiin (found at 640.94 mg/100g DW in plant extracts) . As a chloroplast protein, cemA may indirectly affect these compounds' production by influencing carbon fixation efficiency. Researchers could use the recombinant cemA protein to develop antibodies for tracking native protein levels across different growing conditions, correlating expression with medicinal compound content. Chloroplast membrane integrity, potentially influenced by cemA, might affect the plant's ability to produce antioxidant compounds that contribute to its effectiveness against urinary tract infections and respiratory issues . Studies comparing cemA expression in cultivars with varying medicinal potency could reveal whether the protein contributes to the therapeutic properties that make Nasturtium valuable in traditional and modern herbal medicine applications.

How can structural studies of cemA contribute to understanding chloroplast membrane protein evolution?

Structural studies of Nasturtium officinale cemA can provide significant insights into chloroplast membrane protein evolution through several approaches. Researchers can use the recombinant protein's full 229-amino acid sequence as a basis for comparative genomics analyses across plant lineages, identifying conserved domains that suggest fundamental functions maintained through evolutionary time. X-ray crystallography or cryo-electron microscopy studies of the purified recombinant protein can reveal structural features that might be compared with similar proteins in other species. Homology modeling using the known sequence can generate predictions about structural conservation even before experimental structures are available. Phylogenetic analyses including cemA sequences from diverse plants can trace the protein's evolutionary history and identify selection pressures on different domains. Since cemA (also known as ycf10) is encoded by the chloroplast genome, its evolution rate compared to nuclear-encoded chloroplast proteins offers insights into the co-evolution of the two genomes. These evolutionary insights could ultimately inform biotechnological applications by identifying structurally important regions that should be preserved in protein engineering efforts.

What are the best analytical methods for detecting post-translational modifications in cemA protein?

Detecting post-translational modifications (PTMs) in cemA protein requires a multi-method approach for comprehensive characterization. Mass spectrometry-based proteomics is the cornerstone technique, with specialized workflows for different PTMs: phosphorylation analysis using titanium dioxide enrichment, glycosylation studies using lectins for enrichment, and oxidative modifications detected through redox proteomics approaches. Researchers should employ both bottom-up (peptide-level) and top-down (intact protein) mass spectrometry for complementary coverage. Western blotting with PTM-specific antibodies (anti-phospho, anti-glycan) provides initial screening before more detailed analysis. For membrane proteins like cemA, special consideration must be given to extraction protocols that preserve PTMs while effectively solubilizing the protein. When working with recombinant cemA, researchers should note that expression systems may introduce non-native PTMs or fail to reproduce native modifications . Comparative analysis between recombinant cemA and native protein isolated from Nasturtium officinale chloroplasts (though technically challenging) provides the most complete PTM profile. Site-directed mutagenesis of predicted PTM sites followed by functional assays can confirm the biological significance of identified modifications.

How can researchers distinguish between cemA and other similar chloroplast membrane proteins in experimental settings?

Distinguishing cemA from other chloroplast membrane proteins requires precise identification strategies. Development of highly specific monoclonal antibodies against unique epitopes in the cemA sequence provides the most straightforward approach for Western blotting and immunolocalization studies. Mass spectrometry offers definitive identification through detection of signature peptides unique to cemA's amino acid sequence . When designing experiments, researchers should include controls with known cemA protein alongside samples and perform comparative analysis of tryptic digest patterns. For recombinant protein work, incorporating epitope tags during expression facilitates specific detection . Multiple reaction monitoring (MRM) mass spectrometry targeting cemA-specific peptides enables quantification even in complex samples. Researchers should be aware that cemA (also called ycf10) may share sequence homology with other chloroplast proteins, so identification should rely on multiple unique peptides rather than single-peptide matches. Careful bioinformatic analysis of the Nasturtium officinale chloroplast proteome can identify regions of cemA that are most distinct from other proteins, facilitating development of specific detection methods.

What controls and standards should be included when working with recombinant cemA protein in experimental assays?

When working with recombinant Nasturtium officinale cemA protein, comprehensive controls and standards are essential for experimental rigor. Positive controls should include commercially available recombinant cemA protein with verified activity , while negative controls should incorporate proteins of similar size and membrane characteristics but different function. For protein interaction studies, researchers should include both "bait-only" and "prey-only" controls to identify false positives. When determining protein concentration, multiple complementary methods (Bradford, BCA, and UV absorbance) should be used, as membrane proteins often show method-specific biases. Standards for structural integrity validation should include circular dichroism spectra of properly folded cemA alongside denatured samples. For functional assays measuring potential roles in photosynthesis or membrane transport, researchers should develop dose-response curves with known amounts of recombinant protein. Storage stability controls are critical - activity tests should be performed on freshly prepared protein and on samples stored under recommended conditions (-20°C, 50% glycerol, Tris buffer) for various time periods. Finally, species-specificity controls comparing cemA from Nasturtium with homologs from other plants can distinguish general chloroplast protein properties from Nasturtium-specific characteristics.

How might CRISPR-Cas9 technology be applied to study cemA function in Nasturtium officinale?

CRISPR-Cas9 technology offers powerful approaches to elucidate cemA function in Nasturtium officinale through precise genetic manipulation. Researchers can design guide RNAs targeting the cemA gene in the chloroplast genome to create knockout or knockdown lines, allowing observation of phenotypic changes in photosynthetic efficiency, growth, and metabolite production. The technology also enables introduction of point mutations to specific functional domains identified from the protein's amino acid sequence , creating plants with altered but not abolished cemA function. More advanced applications include creating cemA variants with fluorescent tags for live-cell visualization or affinity tags for in vivo interaction studies. Since cemA may influence the production of medicinal compounds, researchers should analyze changes in glucosinolate content (especially gluconasturtiin) and antioxidant capacity in edited plants compared to wild-type values (CUPRAC: 4.45 mmol TE/g, FRAP: 0.76 mmol TE/g, DPPH: 26.32%) . Technical challenges include developing efficient chloroplast transformation protocols for Nasturtium officinale, as chloroplast genome editing is more complex than nuclear editing. This approach would provide definitive evidence of cemA's role in Nasturtium's biology and potentially its medicinal properties.

What are the potential applications of cemA protein in synthetic biology and artificial photosynthetic systems?

Recombinant cemA protein has significant potential applications in synthetic biology and artificial photosynthetic systems. As a chloroplast envelope membrane protein, cemA could be incorporated into synthetic membrane systems designed to mimic or enhance photosynthetic functions. Researchers could engineer liposomes or nanodiscs containing purified cemA alongside other photosynthetic components to study its contribution to CO₂ uptake or ion transport in controlled environments. The complete amino acid sequence available for recombinant cemA allows for rational design of modified versions with enhanced stability or function for synthetic applications. Biomimetic approaches could incorporate cemA into artificial leaf technologies aiming to capture solar energy with improved efficiency. Synthetic biology applications could extend to creating minimal chloroplast systems, using only essential components including cemA to achieve basic photosynthetic functions. When developing these applications, researchers should consider the native environment of cemA, potentially incorporating lipids similar to those found in Nasturtium chloroplast membranes to maintain protein folding and function. The glycerol-rich storage conditions of recombinant cemA suggest it may have good stability in engineered systems with appropriate formulation.

How can integrative multi-omics approaches advance our understanding of cemA's role in plant metabolism?

Integrative multi-omics approaches can significantly advance understanding of cemA's role in Nasturtium officinale metabolism by connecting different biological information layers. Researchers should combine genomics (analyzing cemA gene structure and variation across ecotypes), transcriptomics (measuring cemA expression under various conditions), proteomics (quantifying protein levels and interactions), and metabolomics (profiling compound changes, particularly glucosinolates like gluconasturtiin at 640.94 mg/100g DW ). This multi-dimensional approach can reveal how cemA expression correlates with production of medicinal compounds and antioxidant activity measured by CUPRAC, FRAP, and DPPH assays . Comparative studies between wild-type plants and those with altered cemA expression (through genetic manipulation) would provide the most comprehensive picture. Bioinformatic integration of these datasets should use network analysis to place cemA within metabolic pathways. Since cemA may influence Nasturtium's environmental responses, studies should include stress conditions relevant to its phytoremediation applications, particularly in cadmium-contaminated soils . The integration of structural biology data from the recombinant protein with functional genomics can connect specific protein domains to metabolic functions, providing a mechanistic understanding of cemA's role in Nasturtium physiology and medicinal properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.