Recombinant Nasturtium officinale NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is Nasturtium officinale NAD(P)H-quinone oxidoreductase subunit 4L and what is its primary function?

NAD(P)H-quinone oxidoreductase subunit 4L (also known as NAD(P)H dehydrogenase subunit 4L or NADH-plastoquinone oxidoreductase subunit 4L) is a chloroplastic protein encoded by the ndhE gene in Nasturtium officinale (watercress). This protein functions as a component of the NAD(P)H dehydrogenase complex in the chloroplast electron transport chain, catalyzing the transfer of electrons from NAD(P)H to plastoquinone. This reaction is represented by EC 1.6.5.- and plays a crucial role in cyclic electron flow around photosystem I, contributing to ATP synthesis during photosynthesis without net production of NADPH. The protein facilitates adaptation to varying light conditions and environmental stresses in the plant, making it essential for optimal photosynthetic efficiency and plant survival under challenging conditions .

What are the optimal storage and handling conditions for the recombinant protein?

For optimal stability and activity maintenance, recombinant Nasturtium officinale NAD(P)H-quinone oxidoreductase subunit 4L should be stored in a Tris-based buffer containing 50% glycerol. The recommended storage temperature is -20°C for regular use, or -80°C for extended storage periods. Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing significantly reduces protein stability and activity. The high glycerol concentration (50%) in the storage buffer prevents ice crystal formation that could damage the protein structure during freezing .

When handling the protein, minimize exposure to room temperature and use sterile technique to prevent microbial contamination that could introduce proteases. Avoid vigorous shaking or vortexing, which can lead to protein denaturation through air-liquid interface effects.

What are the recommended assay conditions for measuring NAD(P)H-quinone oxidoreductase activity?

To accurately assess NAD(P)H-quinone oxidoreductase activity, researchers should employ a spectrophotometric approach monitoring the oxidation of NAD(P)H at 340 nm (ε = 6.22 mM−1cm−1). The standard reaction mixture should contain:

The reaction should be initiated by adding the enzyme to pre-warmed (30°C) reaction mixture and measuring the decrease in absorbance over time. For kinetic analysis, vary the concentration of NAD(P)H or quinone substrates to determine Km and Vmax values. Include appropriate negative controls (heat-inactivated enzyme) and positive controls (commercially available NAD(P)H dehydrogenase) to validate assay performance.

Alternative electron acceptors such as ferricyanide or dichlorophenolindophenol (DCIP) can be used if plastoquinone availability is limited, though these may show different kinetic parameters compared to the native substrate.

How can I validate the structural integrity of the recombinant protein?

Multiple complementary approaches should be employed to validate structural integrity:

• SDS-PAGE analysis: Confirm the molecular weight corresponds to approximately 11 kDa.

• Western blotting: Use antibodies against the tag or the protein itself to verify identity.

• Circular dichroism (CD) spectroscopy: Assess secondary structure content, particularly alpha-helical content expected in transmembrane proteins.

• Size exclusion chromatography: Evaluate oligomeric state and homogeneity.

• Mass spectrometry: Confirm exact mass and potential post-translational modifications.

For transmembrane proteins like NAD(P)H-quinone oxidoreductase subunit 4L, structural integrity is highly dependent on the membrane environment. Consider incorporating the protein into nanodiscs or liposomes to maintain native-like conformational states during analysis. Detergent selection is crucial; mild detergents like n-dodecyl β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are generally suitable for maintaining functionality while solubilizing the protein.

What expression systems are most effective for producing functional recombinant chloroplastic proteins?

For chloroplastic proteins like NAD(P)H-quinone oxidoreductase subunit 4L, several expression systems can be considered, each with advantages and limitations:

For this specific chloroplastic protein, a plant-based expression system might be particularly beneficial to ensure proper folding and authentic functionality. The PlantForm temporary immersion system used for Nasturtium officinale microshoot cultures could be adapted for recombinant protein expression, potentially yielding functional protein with native-like properties .

How does NAD(P)H-quinone oxidoreductase subunit 4L contribute to stress responses in Nasturtium officinale?

NAD(P)H-quinone oxidoreductase subunit 4L plays a significant role in plant stress responses through several mechanisms:

• Cyclic electron transport regulation: Under high light or drought stress, this protein helps maintain the proton gradient across the thylakoid membrane by facilitating cyclic electron flow, thereby supporting ATP production without accumulating excess reducing power.

• Photoprotection: The NAD(P)H dehydrogenase complex helps dissipate excess excitation energy under stress conditions, preventing formation of reactive oxygen species that could damage photosynthetic apparatus.

• Carbon metabolism adjustment: By modulating the ATP/NADPH ratio, the complex influences carbon assimilation pathways during stress conditions.

Nasturtium officinale's adaptation to its aquatic or semi-aquatic habitat may involve specialized functions of this protein complex. The plant's rich profile of bioactive compounds, including glucosinolates like glucobrassicin (493.00 mg/100 g DW) and gluconasturtiin (268.04 mg/100 g DW), as well as phenolic compounds like sinapinic acid (114.83 mg/100 g DW) and ferulic acid (87.78 mg/100 g DW), may be indirectly influenced by chloroplast energy metabolism involving NAD(P)H-quinone oxidoreductase .

Research into this protein's role in stress responses would benefit from comparing expression levels and activity under various stress conditions, potentially correlating changes with production of stress-responsive metabolites in Nasturtium officinale.

What approaches can elucidate protein-protein interactions within the chloroplastic NAD(P)H dehydrogenase complex?

Investigating protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 4L requires specialized approaches due to its membrane-embedded nature:

• Co-immunoprecipitation with crosslinking: Apply membrane-permeable crosslinkers to stabilize transient interactions before solubilization.

• Split reporter systems: For in vivo analysis, consider split GFP or split luciferase complementation assays with careful design of fusion constructs to avoid disrupting membrane topology.

• Blue native PAGE: Separate intact protein complexes from solubilized thylakoid membranes followed by Western blotting or second-dimension SDS-PAGE to identify complex components.

• Proximity labeling: APEX2 or BioID fusion constructs can identify proteins in close proximity in the native membrane environment.

• Cryo-electron microscopy: For structural characterization of the entire NAD(P)H dehydrogenase complex with subunit 4L in its native conformation.

For membrane proteins, conventional yeast two-hybrid systems are often ineffective. Instead, specialized membrane yeast two-hybrid (MYTH) or split-ubiquitin systems are more appropriate. When designing constructs, carefully consider the transmembrane topology to ensure that fusion tags do not disrupt native interactions or membrane insertion.

How does the function of this protein relate to the unique phytochemical profile of Nasturtium officinale?

While direct evidence linking NAD(P)H-quinone oxidoreductase subunit 4L to specific metabolite production is limited, several hypothetical connections warrant investigation:

The chloroplastic electron transport chain, of which this protein is a component, provides reducing power and energy for various biosynthetic pathways. The high content of glucosinolates in Nasturtium officinale, particularly glucobrassicin (493.00 mg/100 g DW) and gluconasturtiin (268.04 mg/100 g DW), requires substantial reducing power for biosynthesis . Efficient functioning of the NAD(P)H dehydrogenase complex could support these biosynthetic demands by maintaining appropriate ATP/NADPH ratios.

Similarly, the significant presence of phenolic compounds like sinapinic acid (114.83 mg/100 g DW) and ferulic acid (87.78 mg/100 g DW) suggests active phenylpropanoid metabolism, which depends on products of photosynthetic electron transport . The antioxidant capacity of Nasturtium officinale extracts might be indirectly supported by efficient photosynthetic electron transport that minimizes reactive oxygen species generation.

Research questions to explore these connections include:

• Does modulation of NAD(P)H dehydrogenase activity correlate with changes in specialized metabolite profiles?

• How do environmental conditions that affect photosynthetic electron transport influence glucosinolate accumulation?

• Can the unique aquatic habitat adaptation of Nasturtium officinale be linked to specialized functions of its chloroplastic electron transport components?

How can computational approaches enhance our understanding of this protein's structure and function?

Computational approaches offer valuable insights into NAD(P)H-quinone oxidoreductase subunit 4L structure and function, especially given the challenges of experimental structure determination for membrane proteins:

• Homology modeling: Using structures of homologous proteins from other species as templates can predict the 3D structure. For this 101-amino acid protein, suitable templates might include resolved structures of NAD(P)H dehydrogenase complexes from cyanobacteria or other plants.

• Molecular dynamics simulations: Simulating the protein embedded in a lipid bilayer can reveal conformational dynamics and potential substrate interaction sites. Key parameters include:

  • Simulation time: Minimum 100-200 ns for equilibration

  • Membrane composition: Phosphatidylcholine/phosphatidylglycerol mixture to mimic thylakoid membranes

  • Force field: CHARMM36m or AMBER14SB with lipid parameters

• Quantum mechanics/molecular mechanics (QM/MM): For investigating the electron transfer mechanism, applying QM calculations to the active site while treating the rest of the protein with MM can provide insights into catalytic mechanisms.

• Co-evolutionary analysis: Methods like Direct Coupling Analysis can predict residue contacts and inform about protein-protein interaction surfaces within the NAD(P)H dehydrogenase complex.

• AlphaFold2 or RoseTTAFold: These AI-based structure prediction tools can provide highly accurate models, particularly useful for proteins with limited experimental structural data.

When conducting computational studies, validation against experimental data (even limited data) is crucial for establishing model reliability.

What are the key functional domains in NAD(P)H-quinone oxidoreductase subunit 4L and how do they contribute to catalytic activity?

Based on sequence analysis and comparison with homologous proteins, NAD(P)H-quinone oxidoreductase subunit 4L likely contains several functional domains:

• Transmembrane helices: The sequence "MILEHVLVLSAYLFLIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGDIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK" suggests multiple hydrophobic segments that form membrane-spanning helices, anchoring the protein within the thylakoid membrane .

• Quinone binding region: Typically contains aromatic and hydrophobic residues that facilitate π-stacking interactions with the quinone ring structure.

• Subunit interaction interfaces: Specific regions mediate interactions with other components of the NAD(P)H dehydrogenase complex, ensuring proper assembly and electron transfer pathways.

The exact boundaries of these domains require experimental verification through techniques such as:

• Site-directed mutagenesis of conserved residues

• Hydrogen-deuterium exchange mass spectrometry

• Limited proteolysis coupled with mass spectrometry

• Cysteine accessibility studies

Understanding these domains will inform structure-function relationships and potentially allow rational design of mutations to investigate specific aspects of protein function.

How does this protein compare to homologous proteins in other Brassicaceae species?

NAD(P)H-quinone oxidoreductase subunit 4L is generally well-conserved among Brassicaceae species due to its essential role in chloroplast electron transport. Comparative analysis reveals:

Sequence conservation is typically highest in the transmembrane regions and at interaction interfaces with other subunits of the NAD(P)H dehydrogenase complex. The high degree of conservation suggests strong evolutionary pressure to maintain function across Brassicaceae.

Nasturtium officinale, being adapted to aquatic or semi-aquatic environments unlike many other Brassicaceae, might exhibit subtle specialized adaptations in this protein. Research comparing enzyme kinetics and stress responses between species could reveal adaptations related to habitat specialization.

What is known about evolutionary aspects of chloroplastic NAD(P)H dehydrogenase complexes?

The chloroplastic NAD(P)H dehydrogenase complex, including subunit 4L, has a fascinating evolutionary history:

• Endosymbiotic origin: The complex originated from the cyanobacterial ancestor of chloroplasts, with subsequent gene transfer to the nuclear genome for most subunits.

• Differential retention: While some plant lineages have lost functional NAD(P)H dehydrogenase complexes, Brassicaceae retain the full complex, suggesting important adaptive functions in these species.

• Functional adaptation: Changes in the complex composition and regulation across plant lineages reflect adaptation to different photosynthetic demands and environmental conditions.

• Co-evolution with photosystems: The evolution of this complex is intertwined with changes in photosystems I and II, reflecting optimization of the entire photosynthetic apparatus.

The presence of this complex in Nasturtium officinale, with its unique habitat requirements and rich phytochemical profile, raises interesting questions about the role of chloroplast energetics in adaptive metabolism. The complex might contribute to the plant's ability to synthesize high levels of bioactive compounds like glucosinolates and phenolics, which require substantial energy and reducing power from chloroplast metabolism .

What are common challenges when working with chloroplastic membrane proteins and how can they be addressed?

Working with chloroplastic membrane proteins like NAD(P)H-quinone oxidoreductase subunit 4L presents several specific challenges:

• Solubilization issues:

  • Challenge: Maintaining protein structure and function during extraction from membranes

  • Solution: Screen multiple detergents (DDM, digitonin, LMNG) at various concentrations; consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for extraction with surrounding lipids

• Low expression yields:

  • Challenge: Membrane proteins often express poorly in recombinant systems

  • Solution: Optimize codon usage, use specialized expression strains, lower induction temperature (16-20°C), consider fusion tags that enhance folding

• Assay interference:

  • Challenge: Detergents can interfere with activity assays

  • Solution: Validate assays with detergent-only controls, use detergent-compatible assay formats, reconstitute protein in liposomes for activity measurements

• Protein aggregation:

  • Challenge: Tendency to aggregate during purification and storage

  • Solution: Include glycerol (10-50%) in all buffers, avoid freeze-thaw cycles, maintain constant low temperature during handling

• Structural heterogeneity:

  • Challenge: Multiple conformational states complicating structural studies

  • Solution: Use ligands or inhibitors to stabilize specific conformations, optimize buffer conditions (pH, ionic strength), consider lipid composition

For this specific chloroplastic protein, maintaining the native-like lipid environment is critical for preserving function. Consider PlantForm bioreactor cultivation of the native organism as an alternative to recombinant expression, as it may provide more authentic protein in its native context .

How can I troubleshoot inconsistent activity measurements in NAD(P)H-quinone oxidoreductase assays?

Inconsistent activity measurements are common when working with membrane-bound enzymes like NAD(P)H-quinone oxidoreductase. A systematic troubleshooting approach includes:

• Buffer composition analysis:

  • Issue: pH changes or incompatible components affecting activity

  • Solution: Verify pH before and after assay; test multiple buffer systems (HEPES, Tris, phosphate) at various concentrations

• Substrate quality verification:

  • Issue: NAD(P)H and quinone substrate degradation

  • Solution: Prepare fresh substrates for each experiment; verify NAD(P)H quality spectrophotometrically; store quinones under nitrogen and protected from light

• Protein stability assessment:

  • Issue: Activity loss during storage or handling

  • Solution: Perform time-course stability tests; add stabilizing agents (glycerol, specific lipids); optimize protein concentration

• Detergent interference:

  • Issue: Variation in detergent concentration affecting activity

  • Solution: Standardize detergent concentration; test activity in various detergent-to-protein ratios; consider proteoliposome reconstitution

• Validation with controls:

  • Issue: Assay system inconsistencies

  • Solution: Include positive controls (commercial dehydrogenase enzymes) and negative controls (heat-inactivated enzyme) in every experiment

A systematic data collection table should be maintained:

This methodical approach will help identify the sources of variability and establish robust, reproducible assay conditions.