Recombinant Nasturtium officinale Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Photosystem II

CP47 is essential for PSII assembly and function, acting as a core antenna protein that binds 16 chlorophyll a molecules and 4 β-carotene molecules . Its primary roles include:

  1. Energy Transfer: Facilitates excitation energy transfer from chlorophyll to the PSII reaction center (D1/D2 proteins).

  2. Structural Support: Anchors the PSII core complex and stabilizes the oxygen-evolving cluster .

  3. Chlorophyll Biosynthesis Regulation: Interacts with chlorophyll precursors, influencing PSII assembly efficiency .

Research Insights

  • Assembly Dynamics: CP47 binds to the D1/D2 reaction center early in PSII biogenesis, forming a precursor complex before CP43 integration .

  • Site Energy Heterogeneity: Computational studies reveal electrostatic protein effects on chlorophyll excitation energies, with B3 and B1 chlorophylls showing the most red-shifted spectra .

  • Mutational Impact: Mutations in CP47 can disrupt PSII assembly, but pseudorevertants with reduced ferrochelatase activity restore functionality by increasing chlorophyll availability .

Research Applications

The recombinant protein is used to study:

ApplicationDetails
BiogenesisIsolation of CP47-His complexes to track assembly intermediates .
Structural StabilityMolecular dynamics simulations to assess conformational changes in isolated CP47 .
Pigment-Protein InteractionsSpectroscopic analysis of chlorophyll and β-carotene binding in vitro .
Cross-Species ComparisonsFunctional studies contrasting Nasturtium officinale CP47 with cyanobacterial or lettuce (e.g., Lactuca sativa) homologs .

Comparative Analysis with Other CP47 Proteins

FeatureNasturtium officinale CP47Lactuca sativa CP47Cyanobacterial CP47
SourceRecombinant (E. coli)Recombinant (E. coli)Native or recombinant
TagHisHisNone or His
Pigment Binding16 Chl a, 4 β-carotene16 Chl a, 4 β-carotene16 Chl a, 4 β-carotene
Primary UsePlant PSII studiesStructural/computational modelsBiochemical assays

Data from .

Challenges and Considerations

  1. Structural Instability: Isolated CP47 may lose pigments (e.g., B1 chlorophyll, β-carotene h1) due to conformational changes, limiting in vitro studies .

  2. Chlorophyll Biosynthesis: CP47 accumulation depends on chlorophyll availability, as seen in mutants where ferrochelatase inhibition restores PSII assembly .

  3. Handling Protocols: Repeated freeze-thaw cycles degrade the protein; aliquoting and storage at -20°C/-80°C are critical .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of this product depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Nasturtium officinale (Water-cress) (Rorippa nasturtium-aquaticum)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEVFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
CP47 (Photosystem II chlorophyll apoprotein, encoded by the psbB gene) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient that is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CP47 chlorophyll apoprotein in Photosystem II?

CP47 is one of the integral antenna proteins of the oxygen-evolving photosystem II (PSII) complex that plays a crucial role in efficient excitation energy transfer to the PSII reaction center. The protein contains 16 chlorophyll molecules whose spatial arrangement and electronic properties define the mechanisms of energy transfer within the photosynthetic apparatus . Structurally, CP47 is a 47 kDa protein that binds chlorophyll a molecules and serves as an internal antenna system for PSII. The protein is encoded by the psbB gene and consists of 508 amino acid residues in Nasturtium officinale .

How does recombinant CP47 from Nasturtium officinale differ from CP47 in other plant species?

Recombinant CP47 from Nasturtium officinale (watercress) possesses a specific amino acid sequence (UniProt accession: A4QLV9) that distinguishes it from homologs in other plants . While the core structure and function remain conserved across species, subtle sequence variations can affect protein stability, pigment binding affinities, and spectroscopic properties. These differences may influence experimental outcomes when using the recombinant protein for comparative studies.

When conducting comparative analyses, researchers should note that Nasturtium officinale CP47 contains specific structural elements that may result in slightly different excitation energy transfer dynamics compared to other model organisms. The protein sequence contains multiple transmembrane helices and pigment-binding sites that have co-evolved with other components of the photosynthetic apparatus in this particular species. These evolutionary adaptations reflect the specific light environments encountered by watercress in its natural aquatic habitat. Cross-species comparative studies should account for these variations when interpreting experimental results and developing models of PSII function.

What are the optimal storage and handling conditions for recombinant CP47 protein?

For optimal stability and activity retention, recombinant CP47 chlorophyll apoprotein from Nasturtium officinale should be stored in Tris-based buffer with 50% glycerol at -20°C, with extended storage recommended at -80°C . Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of functional properties. For working stocks, storage at 4°C for up to one week is acceptable, though activity should be monitored if extended periods at this temperature are necessary.

When handling the protein for experiments, it's crucial to minimize exposure to strong light, which can cause photooxidative damage to both the protein and bound pigments. Working under dim green light is recommended for sample preparation. Additionally, the presence of reducing agents (such as β-mercaptoethanol or DTT) in experimental buffers can help maintain protein stability by preventing oxidation of sulfhydryl groups. For experiments requiring removal of glycerol, gentle dialysis against appropriate buffers is preferable to harsh precipitation methods that might disrupt the native protein structure or pigment interactions.

What spectroscopic techniques are most effective for studying excitation energy transfer in CP47?

For investigating excitation energy transfer dynamics in CP47, a complementary suite of advanced spectroscopic techniques yields the most comprehensive insights. Time-resolved fluorescence spectroscopy with picosecond to femtosecond resolution provides direct measurement of excitation energy transfer rates between chlorophyll molecules within the protein complex. This technique can resolve the kinetic components associated with energy migration through the antenna system to the reaction center.

Circular dichroism (CD) spectroscopy offers valuable information about the spatial arrangement of chlorophyll molecules in CP47, as the CD signal is highly sensitive to the relative orientations of the pigments. Transient absorption spectroscopy provides additional insights by tracking the excited state dynamics following photoexcitation, revealing the pathways of energy transfer through the detection of short-lived intermediate states. Recent quantum chemical calculations have identified specific chlorophyll molecules (particularly B3 and B1) as being the most red-shifted in CP47, challenging previous hypotheses in the literature . These computational findings should be validated using site-specific mutagenesis coupled with these advanced spectroscopic approaches to map the complete energy transfer landscape within the protein.

How can researchers effectively stabilize CP47 against proteolytic degradation during purification and analysis?

Effective stabilization of CP47 against proteolytic degradation requires careful optimization of both pigment concentration and type during purification procedures. Experimental evidence indicates that Zn-pheophytin a provides superior stabilization compared to chlorophyll a, requiring lower concentrations to achieve equivalent protection of the apoprotein . For optimal results, researchers should aim for Zn-pheophytin a concentrations between 90-300 pmol per 4.2 × 10^7 experimental units, as higher concentrations can paradoxically reduce the yield of stabilized protein .

The stabilization mechanism appears to involve specific binding of pigments to vulnerable regions of the apoprotein, preventing access by proteolytic enzymes. A methodological approach combining gentle detergent solubilization (typically with n-dodecyl-β-D-maltoside) and the addition of protease inhibitor cocktails throughout purification is recommended. Additionally, maintaining low temperatures (0-4°C) during all preparation steps significantly reduces proteolytic activity. For long-term experiments, researchers should consider the inclusion of specific protease inhibitors targeting serine and cysteine proteases, which have been identified as primary agents of CP47 degradation in various experimental systems.

Stabilizing CompoundOptimal Concentration RangeEffect on CP47 StabilityNotes for Experimental Design
Zn-pheophytin a90-300 pmol per 4.2 × 10^7 unitsHighly effective, superior to chlorophyll aEfficiency decreases at higher concentrations
Chlorophyll a400-600 pmol per 4.2 × 10^7 unitsModerately effectiveStability not affected by higher concentrations
Protease inhibitor cocktailManufacturer recommendedComplementary to pigment-based stabilizationEssential for preparations from native tissue
Temperature reduction0-4°CSignificant reduction in degradation rateMust be maintained throughout purification

What are the current computational approaches for modeling CP47 site energies and excitation energy transfer?

State-of-the-art computational modeling of CP47 site energies and excitation energy transfer pathways employs multiscale quantum mechanics/molecular mechanics (QM/MM) approaches. Current research utilizes time-dependent density functional theory with modern range-separated functionals to calculate the excitation energies of all chlorophyll molecules in CP47 within complete membrane-embedded photosystem II dimer models . This advanced methodology quantifies the critical electrostatic effects of the protein environment on chlorophyll site energies, providing high-resolution quantum chemical excitation profiles that were previously unattainable.

These computational approaches have revealed that chlorophylls B3 and B1 are the most red-shifted within the CP47 antenna complex, challenging earlier hypotheses in the literature . For researchers implementing these methods, several considerations are paramount: (1) the selection of appropriate functional and basis sets significantly impacts the accuracy of calculated site energies; (2) proper equilibration of the molecular dynamics simulations is essential for representative sampling of protein conformations; and (3) inclusion of the complete protein environment, including membrane components, is necessary to capture all relevant electrostatic interactions. Future directions in this field include coupling these electronic structure calculations with quantum dynamics simulations to model the complete energy transfer process, including coherent effects that may play roles in efficient energy migration through the antenna complex.

How can CP47 research contribute to artificial photosynthetic systems development?

Research on CP47 chlorophyll apoprotein provides critical insights for designing more efficient artificial photosynthetic systems by elucidating the fundamental principles of natural light-harvesting processes. The specific spatial arrangement of chlorophyll molecules within CP47 creates excitation energy funnels that achieve near-perfect quantum efficiency in energy transfer. By understanding these design principles, researchers can develop biomimetic light-harvesting arrays that incorporate the essential features of natural systems while potentially improving upon them for specific applications.

Methodologically, this translation from natural to artificial systems requires detailed structural and spectroscopic characterization of CP47, followed by systematic simplification to identify the minimal structural elements required for efficient energy transfer. Recent computational studies identifying chlorophylls B3 and B1 as the most red-shifted pigments in CP47 provide specific targets for biomimetic designs . Researchers pursuing this direction should consider hybrid approaches that combine protein-based and synthetic molecular components, potentially creating semi-synthetic systems that maintain the efficiency of natural light-harvesting while adding robustness and tunability for technological applications. Additionally, understanding how CP47 interfaces with other PSII components can inform the development of modular artificial photosynthetic assemblies with optimized connectivity between light-harvesting and catalytic functions.

What techniques can resolve contradictions in CP47 site energy assignments across different studies?

Resolving contradictions in CP47 site energy assignments requires a multi-technique approach that combines advanced spectroscopy with site-directed mutagenesis and computational modeling. Researchers should implement a systematic protocol that begins with high-resolution spectroscopic measurements (including low-temperature absorption, fluorescence, and linear/circular dichroism) performed on identical samples under standardized conditions. These experimental measurements should then be compared with predictions from quantum chemical calculations using consistent methodology across studies .

Site-directed mutagenesis targeting amino acids in the vicinity of specific chlorophyll binding sites provides a powerful approach for validating assignments. By selectively modifying the protein environment around individual chlorophylls and measuring the resulting spectral changes, researchers can establish direct connections between specific protein residues and the spectroscopic properties of bound pigments. To systematically resolve contradictions in the literature, a collaborative approach utilizing round-robin testing among laboratories, with identical protein samples and standardized measurement protocols, can identify and minimize methodological variations that may contribute to discrepant results. When implementing this approach, it's essential to carefully control factors such as detergent concentration, ionic strength, and pH, as these can significantly affect the conformational state of the protein and consequently the energetic coupling between chlorophyll molecules.

How does the structural stability of isolated CP47 compare to its stability within the complete PSII complex?

The structural stability of isolated CP47 differs significantly from its stability within the native PSII complex, with important implications for experimental design and data interpretation. Molecular dynamics simulations of isolated CP47 reveal regions of increased flexibility compared to the membrane-embedded complete PSII complex, particularly in loop regions and at interfaces normally stabilized by interactions with adjacent proteins . These differences in dynamic behavior can affect spectroscopic properties and energy transfer characteristics, potentially leading to discrepancies between measurements on isolated CP47 and those performed in the native environment.

For researchers working with isolated CP47, several methodological considerations can help mitigate these stability differences. Incorporating appropriate lipids or detergents that mimic the native membrane environment can provide stabilizing interactions similar to those present in the complete PSII complex. Temperature control is particularly important, as isolated CP47 shows increased thermal sensitivity compared to the integrated protein. Experimental timescales should be carefully considered, as prolonged measurements may be affected by progressive structural changes in the isolated protein. Comparative studies should ideally include measurements on both isolated CP47 and the complete PSII complex to directly assess environmental effects on the properties of interest. This parallel approach allows researchers to distinguish intrinsic properties of CP47 from those that emerge from its interactions within the larger photosynthetic machinery.

What are the unresolved questions regarding the role of CP47 in photoprotective mechanisms?

Despite extensive research on photosynthetic light-harvesting, significant questions remain regarding CP47's role in photoprotective mechanisms that prevent photodamage under high light conditions. Current evidence suggests that conformational changes in CP47 may contribute to energy-dependent quenching processes, but the specific molecular mechanisms remain poorly characterized. Research challenges include identifying the precise sites of non-photochemical quenching within the protein and determining how structural dynamics regulate transitions between light-harvesting and photoprotective states.

Methodologically, addressing these questions requires combining time-resolved spectroscopy with techniques that can probe protein structural dynamics under varying light conditions. An effective experimental approach would implement correlation of ultrafast spectroscopic measurements with real-time tracking of protein conformational changes, potentially using site-specific labels and FRET-based methods. Comparative studies of CP47 from different species adapted to various light environments could provide evolutionary insights into photoprotective mechanisms. Additionally, systematic investigation of how specific pigment-protein interactions in CP47 respond to pH changes, known to accompany high light stress, would help elucidate the molecular triggers for photoprotective responses. This research direction has significant implications for improving crop photosynthetic efficiency under fluctuating field conditions.

How can researchers effectively incorporate isotope labeling to study CP47 protein dynamics?

Isotope labeling offers powerful approaches for studying CP47 protein dynamics but requires careful methodological considerations for successful implementation. Selective isotope labeling of specific amino acids (particularly those involved in chlorophyll binding or at domain interfaces) enables detailed investigation of local protein dynamics using NMR spectroscopy or vibrational spectroscopy. For effective incorporation of these labels, researchers should consider expressing the recombinant protein in systems that allow controlled amino acid supplementation during growth, such as auxotrophic bacterial strains.

For studies focusing on pigment-protein interactions, dual-labeling approaches incorporating both protein and chlorophyll isotope labels can reveal coupled dynamics at the molecular interface. Methodologically, this requires careful coordination of protein expression and pigment reconstitution steps to ensure proper assembly of the labeled components. When designing these experiments, researchers should prioritize labeling sites that minimally perturb the native protein structure while maximizing spectroscopic detection sensitivity. Time-resolved experiments combining isotope labeling with techniques such as 2D-IR spectroscopy can provide unprecedented insights into the dynamic coupling between protein motions and energy transfer processes. This information is essential for developing accurate models of how protein conformational changes modulate photosynthetic function under varying environmental conditions.

What emerging technologies might revolutionize our understanding of CP47 function in the next decade?

Several emerging technologies promise to transform our understanding of CP47 function in the coming decade. Cryo-electron microscopy (cryo-EM) with improved resolution is likely to reveal previously undetectable structural details, particularly regarding the dynamic regions of CP47 that may be poorly resolved in current structures. This enhanced structural information, combined with advances in computational power, will enable more accurate quantum mechanical modeling of the complete energy transfer landscape within the protein.

Single-molecule spectroscopy techniques are increasingly capable of resolving energy transfer events in individual protein complexes, potentially revealing heterogeneity in CP47 function that is masked in ensemble measurements. Methodologically, implementing these techniques requires careful sample preparation to immobilize proteins while maintaining their native conformation and function. The development of ultrafast X-ray free electron laser (XFEL) technology offers unprecedented opportunities to capture structural snapshots during energy transfer processes, potentially revealing transient conformational states that facilitate efficient energy migration. For researchers entering this field, developing expertise in integrating data across these diverse cutting-edge techniques will be crucial for constructing comprehensive models of CP47 function. Additionally, advances in synthetic biology approaches may enable the creation of minimally modified CP47 variants with introduced spectroscopic probes, allowing detailed investigation of specific functional hypotheses without significantly perturbing the native protein architecture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.