Recombinant Nasturtium officinale Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

PsbA/D1 is integral to PSII, where it:

  • Binds the QB plastoquinone, enabling electron transfer from QA to QB .

  • Stabilizes the oxygen-evolving complex (OEC) via its transmembrane structure .

  • Contains redox-active tyrosine residues (YZ) crucial for water splitting .

Alterations in conserved residues (e.g., Ala251) reduce electron transfer rates between QA and QB, as demonstrated in Chlamydomonas reinhardtii mutants .

Recombinant Production Workflow

  1. Gene Cloning: The psbA gene (1–344 aa) is codon-optimized for E. coli expression .

  2. Purification: Affinity chromatography using His-tag .

  3. Quality Control: Validated via SDS-PAGE and functional assays (not detailed in sources) .

Research Applications

  • Photosynthesis Studies: Used to investigate QB site mutations and herbicide resistance .

  • Structural Biology: Templates for cryo-EM studies of PSII architecture .

  • Biotechnology: Potential use in bioengineering stress-tolerant crops .

Comparative Analysis with Native Protein

FeatureNative PsbA/D1Recombinant PsbA/D1
SourceNasturtium officinale thylakoidsE. coli expression system
Post-Translational ModificationsLikely present (e.g., phosphorylation)Absent (prokaryotic expression)
Functional ActivityFully active in PSIIRequires reconstitution

Research Gaps and Future Directions

  • Functional Assays: No peer-reviewed studies directly testing the recombinant protein’s electron transport activity were identified.

  • Structural Data: Atomic-resolution structures of the recombinant protein are unavailable.

  • Agricultural Relevance: Potential links to carotenoid biosynthesis genes (e.g., NoPSY, NoPDS) in N. officinale remain unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Nasturtium officinale (Water-cress) (Rorippa nasturtium-aquaticum)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein and what is its function in Nasturtium officinale?

Photosystem Q(B) protein, also known as Photosystem II protein D1 or PSII D1 protein, is a crucial component of the photosynthetic machinery in Nasturtium officinale (watercress). This protein is encoded by the psbA gene and forms part of the reaction center of Photosystem II (PSII) . The Q(B) site within this protein serves as the binding site for plastoquinone (PQ), which accepts electrons during the light reactions of photosynthesis. The primary function of this protein is to facilitate electron transfer from the primary quinone electron acceptor (QA) to the secondary quinone acceptor (QB), which ultimately leads to the reduction of plastoquinone to plastoquinol (PQH2) . This electron transfer is fundamental to the establishment of the proton gradient used for ATP synthesis during photosynthesis in Nasturtium officinale, similar to its function in other photosynthetic organisms.

What are the general properties of recombinant Nasturtium officinale Photosystem Q(B) protein?

Recombinant Nasturtium officinale Photosystem Q(B) protein can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells, each potentially affecting protein properties . The protein is typically obtained as a lyophilized powder and requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol for long-term storage . The recombinant protein can be produced with various tags to facilitate purification and detection, including Avi-tag biotinylation, which involves the specific covalent attachment of biotin to a 15 amino acid AviTag peptide catalyzed by E. coli biotin ligase (BirA) . The purity of commercially available recombinant protein is typically >85% as determined by SDS-PAGE . Understanding these properties is essential for researchers planning experiments with this protein, as the expression system and tag used can influence protein folding, activity, and interaction with other molecules.

What are the detailed energetics of the QB site in Photosystem II, and how do they affect electron transfer?

The energetics of the QB site in Photosystem II have been carefully characterized using electron paramagnetic resonance (EPR) spectroscopy. In Thermosynechococcus elongatus, the midpoint potentials of the QB redox couples have been measured at Em QB/QB- − ≈ 90 mV and Em QB- −/QBH2 ≈ 40 mV . These values yield a combined Em QB/QBH2 of approximately 65 mV, which is lower than the Em PQ/PQH2 in the membrane pool (approximately 117 mV) . This difference of about 50 meV represents the thermodynamic driving force for QBH2 release into the plastoquinone pool after reduction .

The energy gap between QA and QB is particularly important for electron transfer efficiency. The difference between Em QB/QB- − (90 mV) and Em QA/QA- − (typically around -144 mV based on literature) is approximately 234 meV . This substantial energy difference provides significant driving force for electron transfer from QA- − to QB. Functionally, this energy gap has been estimated through thermoluminescence studies associated with QB- −, yielding a similar value of ≥180 meV . Interestingly, these estimates are larger than the generally accepted value of ~70 meV, suggesting that our understanding of PSII energetics may still be evolving .

How does salicylic acid influence Nasturtium officinale photosynthetic efficiency and its potential applications in phytoremediation?

Salicylic acid (SA) has been found to significantly impact the photosynthetic efficiency of Nasturtium officinale, with potential applications in enhancing its phytoremediation capabilities, particularly for cadmium (Cd) contamination. Research has demonstrated that SA at specific concentrations can enhance several parameters relevant to photosynthesis and stress tolerance in Nasturtium officinale.

At a concentration of 150 mg/L, SA increased chlorophyll a and chlorophyll b contents by 13.30% and 17.29%, respectively, compared to control conditions . This enhancement of photosynthetic pigments likely contributes to improved light-harvesting capacity. The effects of various SA concentrations on photosynthetic pigments are summarized in the table below:

TreatmentChlorophyll a (mg/g)Chlorophyll b (mg/g)Chlorophyll a/bCarotenoid (mg/g)
Control1.353 ± 0.053b0.486 ± 0.017b2.784 ± 0.046a0.265 ± 0.004a
100 mg/L1.371 ± 0.027b0.523 ± 0.014ab2.622 ± 0.023b0.274 ± 0.010a
150 mg/L1.533 ± 0.020a0.570 ± 0.014a2.692 ± 0.032ab0.287 ± 0.012a
200 mg/L1.384 ± 0.024b0.521 ± 0.005ab2.655 ± 0.030b0.271 ± 0.008a
250 mg/L1.395 ± 0.038b0.512 ± 0.022ab2.728 ± 0.045ab0.279 ± 0.016a

SA also modulates antioxidant enzyme activities in Nasturtium officinale. With increasing SA concentration, peroxidase (POD) and catalase (CAT) activities increased, while superoxide dismutase (SOD) activity and soluble protein content decreased . At 250 mg/L, SA increased POD activity by 11.40%, and at concentrations of 150, 200, and 250 mg/L, it increased CAT activity by 26.21%, 39.37%, and 54.10%, respectively . These changes in antioxidant enzyme activities likely help Nasturtium officinale cope with oxidative stress associated with heavy metal exposure.

For phytoremediation applications, SA significantly enhances Nasturtium officinale's ability to accumulate cadmium. SA at concentrations of 200 and 250 mg/L increased root Cd content by 19.99% and 26.45%, respectively, while concentrations of 150, 200, and 250 mg/L increased shoot Cd content by 10.69%, 14.02%, and 23.49%, respectively . The relationship between SA concentration and Cd extraction follows a quadratic polynomial regression, with optimal effects at around 150 mg/L . This enhancement of Cd accumulation makes Nasturtium officinale a more effective phytoremediator when treated with appropriate SA concentrations.

What experimental methods are most effective for studying recombinant Photosystem Q(B) protein function?

Effective study of recombinant Photosystem Q(B) protein function requires a multi-faceted approach combining biophysical, biochemical, and spectroscopic techniques. Electron paramagnetic resonance (EPR) spectroscopy has proven particularly valuable for investigating the redox properties of the QB site . This technique can directly detect the semiquinone intermediate (QB- −) and determine midpoint potentials of redox couples, providing insight into the energetics of electron transfer . For example, EPR spectroscopy enabled researchers to determine that the midpoint potentials of QB redox couples in Thermosynechococcus elongatus are approximately Em QB/QB- − ≈ 90 mV and Em QB- −/QBH2 ≈ 40 mV .

Thermoluminescence measurements offer a complementary approach for assessing the energy gap between QA and QB. This technique measures the luminescence associated with charge recombination between the oxidized oxygen-evolving complex and reduced QB, providing a functional estimate of the driving force for electron transfer .

When working with recombinant Photosystem Q(B) protein, the choice of expression system is crucial. Options include yeast, E. coli, baculovirus, and mammalian cells, each with advantages and limitations . E. coli systems offer high yield and ease of genetic manipulation, while eukaryotic systems may provide more appropriate post-translational modifications. The addition of tags, such as Avi-tag biotinylation, can facilitate protein purification and immobilization for various assays .

For functional studies, reconstitution of the recombinant protein into liposomes or nanodiscs can provide a membrane-like environment that better mimics its native state. Activity can then be assessed through measurements of electron transfer rates, oxygen evolution, or fluorescence quenching.

How does Nasturtium officinale's antioxidant capacity relate to its Photosystem II function?

Nasturtium officinale demonstrates significant antioxidant capacity that may be interconnected with its Photosystem II function through several mechanisms. Research has shown that Nasturtium officinale extract exhibits notable scavenging activity against 2,2-diphenyl-1-picrylhydrazyl (DPPH) radicals and potent reducing power in ferric reducing antioxidant power (FRAP) assays . These antioxidant properties may help protect Photosystem II components, including the Q(B) protein, from oxidative damage during photosynthesis.

Photosystem II is particularly vulnerable to photoinhibition and oxidative stress due to the production of reactive oxygen species (ROS) during electron transport, especially under high light conditions. The D1 protein (Photosystem Q(B) protein) is most susceptible to this damage and has the highest turnover rate among photosynthetic proteins. The antioxidant systems in Nasturtium officinale likely play a crucial role in mitigating this damage and maintaining photosynthetic efficiency.

The antioxidant capacity of Nasturtium officinale may also explain its medicinal properties. Studies in hypercholesterolaemic rats have shown that intragastric administration of Nasturtium officinale extract (500 mg/kg body weight per day) for 30 days reduced blood total cholesterol, triglyceride, and low-density lipoprotein cholesterol levels by 37%, 44%, and 48%, respectively . These effects may be mediated through the same antioxidant compounds that protect Photosystem II from oxidative damage.

What are the challenges in producing and working with functional recombinant Photosystem Q(B) protein?

Producing and working with functional recombinant Photosystem Q(B) protein presents several significant challenges that researchers must address. As a membrane protein and component of a complex multi-subunit protein assembly, the Q(B) protein (D1) is notoriously difficult to express and isolate in a functional state outside its native environment.

One primary challenge is selecting an appropriate expression system. While E. coli systems are commonly used for their simplicity and high yield, they may not provide the necessary membrane environment or post-translational modifications required for proper folding and function of the Q(B) protein . Alternative expression systems such as yeast, baculovirus, or mammalian cells may offer advantages in terms of protein folding and modification but typically have lower yields and are more costly and time-consuming .

Protein solubility represents another major obstacle. As an integral membrane protein, the Q(B) protein is highly hydrophobic and tends to aggregate when removed from the membrane environment. Researchers must carefully optimize detergent or lipid compositions to maintain protein solubility while preserving native structure and function. The use of fusion tags, such as Avi-tag, can improve solubility and facilitate purification, but may also affect protein function if not properly designed .

Maintaining the cofactor environment poses additional difficulties. The Q(B) protein functions in coordination with various cofactors, including the plastoquinone molecule itself, which must be correctly positioned for electron transfer. Ensuring that these cofactors are present and correctly oriented in the recombinant protein is essential for functional studies but technically challenging.

Once purified, the recombinant protein requires careful handling and storage. Lyophilized preparations are typically recommended for long-term storage, with reconstitution in appropriate buffers containing glycerol (5-50%) to prevent aggregation . Even with optimal storage conditions, protein stability remains a concern, particularly for functional studies that may require extended experimental timeframes.

For functional studies, researchers must develop appropriate assays to measure electron transfer activities. This often requires reconstitution of the protein into artificial membrane systems or the development of specialized spectroscopic techniques that can detect the subtle electronic changes associated with quinone reduction and protonation.

How can recombinant Nasturtium officinale Photosystem Q(B) protein contribute to understanding herbicide resistance mechanisms?

Recombinant Nasturtium officinale Photosystem Q(B) protein offers valuable opportunities for investigating herbicide resistance mechanisms, particularly for herbicides targeting Photosystem II. Many commercially important herbicides, including triazines, ureas, and phenols, act by competing with plastoquinone for binding at the QB site, thereby disrupting electron transport and photosynthesis. Resistance to these herbicides frequently develops through mutations in the psbA gene encoding the D1 protein, which contains the QB binding site.

Using recombinant Photosystem Q(B) protein, researchers can systematically introduce specific mutations observed in resistant weed biotypes and study their effects on herbicide binding and electron transfer efficiency. The availability of purified recombinant protein enables detailed biochemical and biophysical characterization that would be difficult to perform in whole plants or thylakoid membranes. For instance, researchers could employ techniques such as isothermal titration calorimetry to measure binding affinities of different herbicides to wild-type and mutant versions of the protein, or use EPR spectroscopy to assess changes in the redox properties of the QB site resulting from mutations .

Additionally, recombinant systems allow for high-throughput screening of novel herbicide candidates, potentially leading to the development of compounds that can overcome resistance or that have improved environmental profiles. Structure-function studies using recombinant protein could identify critical regions of the QB binding site that might be targeted by next-generation herbicides.

Understanding the detailed mechanisms of herbicide resistance through studies with recombinant Photosystem Q(B) protein may also provide insights into the evolutionary adaptability of photosynthetic organisms and the constraints on the QB site's structure imposed by its essential role in electron transport.

What is the potential for using Nasturtium officinale in environmental remediation based on its Photosystem II properties?

The phytoremediation capacity of Nasturtium officinale can be significantly enhanced through salicylic acid (SA) treatment. Studies show that SA at concentrations of 100-200 mg/L can increase root Cd extraction by 33.04-50.53% and shoot Cd extraction by 17.59-47.16% compared to controls . The relationship between SA concentration and Cd extraction follows a quadratic polynomial regression (y = -7.981E-5x2 + 0.024x + 3.489, R2 = 0.830 for root Cd extraction; y = -0.001x2 + 0.197x + 34.178, R2 = 0.676 for shoot Cd extraction), with optimal effects around 150 mg/L SA .

Additionally, SA treatment modulates antioxidant enzyme activities in Nasturtium officinale, increasing peroxidase (POD) and catalase (CAT) activities while decreasing superoxide dismutase (SOD) activity . These changes in antioxidant enzyme profiles likely contribute to the plant's enhanced stress tolerance and metal accumulation capacity under SA treatment.

The practical advantages of Nasturtium officinale for phytoremediation include its strong vitality, vigorous growth, wide distribution, and short growth cycle . These characteristics make it a potentially cost-effective and environmentally friendly alternative to conventional remediation techniques for contaminated soils, particularly in aquatic or wetland environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.