Recombinant Natronomonas pharaonis Halorhodopsin (hop)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Natronomonas pharaonis Halorhodopsin (NpHR) is a retinal-binding protein that transports chloride ions across cellular membranes using light energy . It belongs to the microbial rhodopsin family and shares structural homology with bacteriorhodopsin but differs in its ion specificity (Cl⁻ vs. H⁺) . The "hop" designation refers to its gene name in N. pharaonis .

Functional Mechanism

  • Light Activation: Absorption of green-yellow light (∼580 nm) triggers retinal isomerization, initiating Cl⁻ transport .

  • Chloride Transport: Cl⁻ binds extracellularly near Thr126 and Ser81, traverses a hydrophobic cytoplasmic barrier, and is released via conformational changes .

  • Photocycle: Includes intermediates (L2, N, O) with Cl⁻ release associated with the L2→O transition .

Recombinant Production

ParameterDetailsSource
Expression HostE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; stable at -20°C to -80°C
Sequence291 residues (UniProt: P15647), including Val-Asp-His tag in some variants

Stability and Reconstitution

  • Nanodisk Reconstitution: NpHR trimers retain function in nanodisks (NDs) with native archaeal lipids or artificial POPC lipids, though Cl⁻ affinity varies with lipid charge .

  • Detergent Sensitivity: Stable in n-dodecyl-β-D-maltoside (DDM), unlike bacteriorhodopsin trimers .

Critical Mutational Studies

  • Ser81Ala Mutation: Disrupts Thr126-Cl⁻ hydrogen bonding, abolishing ion transport and neuronal hyperpolarization .

  • Asp252 Mutations: Alter Schiff base protonation, affecting Cl⁻ binding and photocycle kinetics .

Spectroscopic Insights

  • Circular Dichroism: Confirms trimer integrity in lipid nanodisks .

  • Transient Grating Spectroscopy: Reveals Cl⁻ release (τ = 1.6 ms) and uptake (τ = 8.4 ms) dynamics during photocycle .

Applications in Biotechnology

  • Optogenetics: Used to silence neuronal activity by hyperpolarizing membranes with yellow light .

  • Membrane Protein Studies: Serves as a model for ion transport mechanisms due to structural robustness .

  • Biosensors: Potential in chloride ion detection systems leveraging its photochemical response .

Challenges and Future Directions

  • Lipid Dependency: Function varies with lipid composition, complicating in vitro applications .

  • Thermal Isomerization: Retinal-protein interactions limit utility in high-temperature environments .

  • Engineering Goals: Improving Cl⁻ transport efficiency and spectral tuning for dual optogenetic systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
hop; Halorhodopsin; HR; NpHR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Natronomonas pharaonis (Natronobacterium pharaonis)
Target Names
hop
Target Protein Sequence
MTETLPPVTESAVALQAEVTQRELFEFVLNDPLLASSLYINIALAGLSILLFVFMTRGLD DPRAKLIAVSTILVPVVSIASYTGLASGLTISVLEMPAGHFAEGSSVMLGGEEVDGVVTM WGRYLTWALSTPMILLALGLLAGSNATKLFTAITFDIAMCVTGLAAALTTSSHLMRWFWY AISCACFLVVLYILLVEWAQDAKAAGTADMFNTLKLLTVVMWLGYPIVWALGVEGIAVLP VGVTSWGYSFLDIVAKYIFAFLLLNYLTSNESVVSGSILDVPSASGTPADD
Uniprot No.

Target Background

Function
Light-driven anion pump. Anion binding affinity follows the order: bromide > chloride > nitrate > azide > bromate. Binding is pH-dependent.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Natronomonas pharaonis Halorhodopsin and what makes it significant for research?

Natronomonas pharaonis halorhodopsin (NpHR) is a light-driven chloride ion pump found in the extremely haloalkaliphilic archaeon Natronomonas pharaonis, which was originally isolated from alkaline salt lakes in Egypt (Soda Lake) and Kenya . NpHR serves as an inward-directed chloride ion pump that transports chloride ions through the cell membrane following light absorption by the retinal chromophore .

The significance of NpHR in research stems from its robust function as an optogenetic tool for neuronal silencing. Unlike other microbial rhodopsins, NpHR offers distinct advantages including: (1) availability in large quantities from the N. pharaonis KM-1 strain that overproduces the protein, (2) formation of stable trimers that maintain integrity even in the presence of detergents, and (3) well-characterized photochemical properties that make it suitable for controlled neuronal inhibition .

How does the structure of NpHR relate to its function as a chloride ion pump?

NpHR functions through a complex structural mechanism involving several key components. The protein contains a retinal chromophore covalently bound to Lys256 via a protonated Schiff base . Upon light absorption, the protein undergoes conformational changes that facilitate chloride ion transport through the membrane.

A critical functional area is binding site-1 (BS1) near the protonated Schiff base, where Thr126 temporarily binds chloride ions during the transport process . Additionally, the extracellular part of helix D plays a crucial role in the chloride uptake process, with significant conformational changes occurring in this region when transitioning between chloride-bound and chloride-free states .

Research using solid-state NMR analysis has revealed that while structural changes caused by chloride depletion affect the entire NpHR molecule, the most significant conformational alterations occur in the extracellular portion of helix D . These movements are essential for creating the chloride entrance pathway on the extracellular surface of the protein.

What conditions are optimal for expressing and handling recombinant NpHR?

For optimal expression and handling of recombinant NpHR, researchers should consider several key factors:

Salt Concentration: The pigment formation of NpHR is regulated by sodium chloride concentration, with maximum yield observed at approximately 3.7 M NaCl. Lower concentrations (<3 M) result in reduced yield due to altered apoprotein conformation that inhibits proper pigment formation .

pH Conditions: The reconstitution process of NpHR from its apoprotein and all-trans retinal depends significantly on pH, with the process demonstrating a pKa of 5.8±0.1. This pKa value is associated with the lysine residue (Lys256) that binds the retinal chromophore . Higher pH values increase the rate of retinal isomerization catalyzed by the apoprotein.

Growth Phase Considerations: When working with the KM-1 mutant strain, researchers should note that it demonstrates constitutive expression of halorhodopsin during the late exponential phase, unlike the inducible expression pattern observed in wild-type strains .

Membrane Preparation: hR-enriched membranes can be efficiently obtained by washing cells with distilled water, resulting in claret-colored membranes due to the presence of both halorhodopsin and bacterioruberin pigments .

What molecular mechanisms govern the chloride transport pathway in NpHR?

The chloride transport mechanism in NpHR involves multiple molecular components working in concert. Recent structural studies have revealed critical insights into this process:

The chloride ion pathway requires specific amino acid residues for proper function. Ser81 plays a key role in maintaining chloride ions near the Schiff base by stabilizing the correct orientation of Thr126 at binding site-1 (BS1) . Molecular dynamics simulations have demonstrated that in wild-type NpHR, the hydrogen bond between Thr126 and the chloride ion is maintained, whereas in S81A mutants, chloride ions tend to leave BS1, indicating that Ser81 is essential for stabilizing the binding state .

The extracellular part of helix D undergoes significant conformational changes during chloride transport. Research using solid-state NMR and dynamic nuclear polarization (DNP) has shown that Ala165, located at the trimer interface, is particularly important for this process . When this residue is mutated to one with a bulkier sidechain (A165V), it significantly disrupts the late photocycle and the trimeric assembly in both chloride-free conditions and during ion-pumping under photo-irradiation .

These findings support a model wherein the outward movement of helix D at the extracellular part is necessary for creating the chloride entrance pathway. This movement temporarily disrupts the trimer integrity during the transport cycle, highlighting the dynamic nature of the protein's quaternary structure during function .

How can researchers effectively reconstitute NpHR into membrane environments for functional studies?

Effective reconstitution of NpHR into membrane environments requires careful consideration of several methodological approaches:

Nanodisk Reconstitution: Single NpHR trimers can be successfully reconstituted into nanodisks (NDs) using either native archaeal lipids (NL) or artificial lipids with zwitterionic headgroups such as 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) . This approach maintains the protein in a native-like membrane environment while allowing for controlled experimental conditions.

Confirmation Methods: Successful incorporation of trimeric NpHR into nanodisks should be verified through multiple techniques:

  • Sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE)

  • Size-exclusion chromatography

  • Visible circular dichroism spectroscopy

Functional Assessment: Chloride binding affinity of reconstituted NpHR can be examined through absorption spectroscopy, which provides information about the chloride-releasing affinities (Km values) under different conditions .

Photocycle Analysis: Flash photolysis and absorption spectroscopy can be used to analyze the photoreaction cycle of reconstituted NpHR, providing insights into protein function in different membrane environments .

Researchers should be aware that functional differences in NpHR reconstituted into different environments may arise from several factors:

  • Variations in bacterioruberin content

  • Different charges on membrane surfaces

  • Suppression of conformational changes associated with chloride release

  • Conformational perturbations in NpHR trimers

  • Lack of intertrimer interactions

What role do specific amino acid residues play in NpHR chloride binding and transport?

Several key amino acid residues have been identified as critical for NpHR function:

Lys256: This residue forms the protonated Schiff base with the retinal chromophore and plays a dual role in both retinal binding and isomerization processes. The pKa values of both the binding process and the isomerization process are similar, suggesting Lys256 involvement in both mechanisms .

Thr126: Located at binding site-1 (BS1) near the protonated Schiff base, Thr126 temporarily binds chloride ions during transport. The interaction between Thr126 and chloride ions is essential for maintaining the ion near the Schiff base during the transport cycle .

Ser81: This residue doesn't directly interact with chloride ions but plays a crucial supporting role by fixing the direction of the Thr126 side chain through hydrogen bonding. Molecular dynamics simulations have shown that S81A mutations decrease the interaction between Thr126 and chloride ions, causing the ions to leave BS1 prematurely .

Ala165: Located at the trimer interface in the extracellular part of helix D, this residue facilitates the conformational changes necessary for creating the chloride entrance pathway. Mutations to bulkier residues (A165V) disrupt the trimeric assembly in chloride-free states and during the photocycle .

Understanding these specific residue functions provides opportunities for protein engineering to modify transport properties for specific research applications.

How does the overexpression of halorhodopsin in the KM-1 mutant strain occur at the molecular level?

The KM-1 mutant strain of Natronomonas pharaonis exhibits significantly higher halorhodopsin production compared to the wild-type strain (DSM2160ᵀ). The molecular basis for this overexpression has been identified:

The overexpression appears to be caused by a specific point mutation (Asp324 → Asn) in the bacteriorhodopsin activator homologues of N. pharaonis . This mutation fundamentally alters the expression pattern of halorhodopsin from inducible to constitutive during the late exponential growth phase.

The mutation changes the regulatory mechanism, resulting in continuous production of halorhodopsin regardless of environmental stimuli that would normally regulate expression in wild-type strains. This constitutive expression leads to significantly higher protein yields, making the KM-1 strain particularly valuable for research applications requiring substantial amounts of pure protein .

The membranes of KM-1 cells contain high concentrations of both halorhodopsin and bacterioruberin, giving them a distinctive claret color. These hR-enriched membranes can be easily isolated by simply washing the cells with distilled water, providing a straightforward purification method .

What spectroscopic techniques are most informative for characterizing NpHR structure and function?

Several spectroscopic techniques have proven valuable for characterizing different aspects of NpHR:

Absorption Spectroscopy: This technique reveals the characteristic spectral shifts of NpHR upon chloride binding. The absorption spectra change from blue to purple upon chloride addition, with a Km value of approximately 1.7 mM . Absorption spectroscopy can also be used to determine chloride binding affinities under various conditions .

Circular Dichroism (CD) Spectroscopy: Visible CD spectroscopy is useful for confirming the proper folding and trimeric assembly of reconstituted NpHR. The technique provides information about the protein's secondary structure and can detect conformational changes in different membrane environments .

Solid-State Nuclear Magnetic Resonance (NMR): This powerful technique allows analysis of NpHR in both chloride-bound and chloride-free states under near-physiological transmembrane conditions. Chemical shift perturbation analysis can identify specific residues that undergo significant conformational changes during the chloride transport cycle .

Dynamic Nuclear Polarization (DNP)-Enhanced Solid-State NMR: This advanced technique provides enhanced sensitivity for detecting subtle structural changes in specific amino acid residues. When combined with point mutations and photochemical analysis, it can confirm the importance of specific residues in the chloride uptake process .

Flash Photolysis: This technique enables real-time monitoring of the photocycle kinetics of NpHR, revealing the formation and decay of photointermediates during the transport cycle. The S81A mutant shows loss of light-induced photocurrent, indicating disruption of the normal transport process .

What are the primary challenges in expressing recombinant NpHR in heterologous systems?

Expressing functional recombinant NpHR in heterologous systems presents several challenges that researchers should address methodically:

Membrane Integration: As a membrane protein, NpHR requires proper insertion into lipid bilayers for function. Heterologous expression systems may not provide the appropriate membrane environment found in the native haloalkaliphilic archaeon, particularly regarding lipid composition and membrane thickness .

Salt Requirements: Natronomonas pharaonis naturally thrives in environments containing approximately 3.5 M NaCl at pH 8.5–9.0 . Maintaining these high salt concentrations can be challenging in most expression systems, yet they are critical for proper protein folding and function. Reconstitution experiments have shown that pigment formation is regulated by sodium chloride concentration, with maximum yield at 3.7 M NaCl .

Retinal Incorporation: Functional NpHR requires the covalent binding of retinal to form the chromophore. Ensuring sufficient retinal availability and proper incorporation in heterologous systems is essential. The reconstitution process depends on pH (pKa of 5.8±0.1) and salt concentration, with both factors affecting the efficiency of pigment formation .

Protein Stability: The unique adaptation of N. pharaonis to extreme environments means that NpHR has evolved to function optimally under conditions that may destabilize proteins in heterologous systems. The trimeric structure of NpHR, while providing stability in native membranes, may be disrupted during expression and purification .

How can researchers optimize NpHR for specific optogenetic applications?

Optimizing NpHR for optogenetic applications requires several strategic approaches:

Trafficking and Membrane Localization: Improving trafficking to the plasma membrane is critical for effective optogenetic silencing. Adding endoplasmic reticulum export signals and trafficking sequences can enhance membrane localization in mammalian cells.

Spectral Tuning: Understanding the relationship between specific amino acid residues and absorption properties can guide mutations that shift spectral sensitivity. Research on retinal-protein interactions has revealed that the protein environment around the chromophore significantly influences spectral properties .

Kinetic Optimization: For temporally precise neuronal silencing, modifying the photocycle kinetics may be beneficial. Studies of specific mutations like S81A have shown how single amino acid changes can dramatically affect the photocycle and ion transport capabilities . By targeting residues involved in conformational changes during the chloride uptake process, particularly in the extracellular part of helix D, researchers can potentially enhance or modify kinetic properties .

Structural Stability Enhancement: The trimeric assembly of NpHR contributes to its stability and function. Understanding factors that affect trimer integrity, such as the role of Ala165 at the trimer interface, can guide modifications to enhance stability under various experimental conditions .

Expression System Selection: For recombinant expression, researchers should consider using the KM-1 mutant strain of N. pharaonis, which constitutively overexpresses halorhodopsin due to a point mutation (Asp324 → Asn) in the bacteriorhodopsin activator homologue .

What methods are available for studying the photocycle and ion transport kinetics of NpHR?

Several sophisticated methods have been developed to study the photocycle and ion transport kinetics of NpHR:

Flash Photolysis: This technique allows time-resolved monitoring of spectral changes following light activation, revealing the formation and decay of photointermediates. Flash photolysis has been used to characterize the photocycle of NpHR in various conditions, including reconstituted nanodisks with different lipid compositions .

Patch-Clamp Electrophysiology: This method directly measures light-induced photocurrents, providing quantitative data on ion transport rates and efficiency. Studies have shown that mutations like S81A can eliminate light-induced photocurrent, indicating disruption of normal ion transport .

Time-Resolved Spectroscopy: Advanced spectroscopic techniques with microsecond to millisecond resolution can track the sequential formation of photointermediates during the transport cycle. These methods are crucial for understanding the relationship between structural changes and functional steps in the transport process.

Molecular Dynamics Simulations: Computational approaches can model the dynamic behavior of NpHR during ion transport, providing insights into conformational changes and ion movements that may be difficult to capture experimentally. MD simulations have revealed, for example, that the hydrogen bond between Thr126 and chloride ions is maintained in wild-type NpHR but disrupted in S81A mutants .

Dynamic Nuclear Polarization (DNP)-Enhanced Solid-State NMR: This advanced technique provides enhanced sensitivity for detecting subtle structural changes in specific amino acid residues during the photocycle. When combined with point mutations and photochemical analysis, it can confirm the importance of specific residues in the chloride uptake process .

How does the catalytic isomerization of retinal by NpHR apoprotein impact its applications in research?

The ability of NpHR apoprotein to catalyze the thermal isomerization of retinal isomers has significant implications for research applications:

NpHR opsin uniquely produces pigments with 11-cis retinal and 9-cis retinal by thermally isomerizing these retinal isomers to all-trans retinal . This differs from the apoprotein of bacteriorhodopsin and represents an unexpected property with research implications.

The isomerization rate depends on pH, occurring faster at higher pH values. The pKa value of the isomerization process is similar to that of the binding process, suggesting that Lys256 is involved in both mechanisms . This provides an opportunity to control isomerization rates through pH manipulation in experimental settings.

Importantly, while the isomerization process is independent of sodium chloride concentration, the absence of sodium chloride alters the apoprotein conformation in a way that prevents covalent bond formation with the lysine residue while still allowing retinal isomerization .

Rate and thermodynamic parameter analysis suggests that the apoprotein catalyzes retinal isomerization via a triplet mechanism . This catalytic capability could potentially be harnessed for biotechnological applications involving retinal isomerization.

What are the comparative advantages of using NpHR versus other inhibitory optogenetic tools?

NpHR offers several distinct advantages compared to other inhibitory optogenetic tools:

Salt Independence in Application: While NpHR requires high salt for optimal expression and folding, once properly folded and integrated into membranes, its function as a chloride pump for neuronal silencing is relatively independent of extracellular salt concentrations, making it suitable for various experimental settings.

Spectral Properties: NpHR absorbs light maximally at wavelengths distinct from excitatory opsins like channelrhodopsin-2, allowing for combinatorial optogenetic approaches with minimal cross-activation .

Structural Stability: NpHR forms robust trimers that maintain integrity even in the presence of detergents like n-dodecyl-β-D-maltoside . This structural stability contributes to reliable function in various experimental contexts.

Well-Characterized Mechanism: The chloride transport mechanism of NpHR has been extensively studied using multiple techniques, providing researchers with detailed understanding of its function . This knowledge base facilitates rational design of experiments and interpretation of results.

Availability from Natural Sources: Large amounts of NpHR can be obtained from the N. pharaonis KM-1 strain, which overproduces the protein due to a point mutation in the bacteriorhodopsin activator homologue . This natural source can provide abundant protein for research applications.

How can researchers effectively troubleshoot common issues in NpHR expression and function?

When encountering difficulties with NpHR expression and function, researchers should systematically address several potential issues:

Poor Expression Levels:

  • Verify culture conditions match the requirements of N. pharaonis (3.5 M NaCl, pH 8.5-9.0)

  • If using KM-1 strain, ensure cells are harvested during late exponential phase when constitutive expression occurs

  • For recombinant systems, check codon optimization for the host organism

Reduced Function After Reconstitution:

  • Examine salt concentration during reconstitution, as maximum pigment yield occurs at 3.7 M NaCl

  • Verify pH conditions are appropriate (pKa of reconstitution process is 5.8±0.1)

  • Consider lipid composition effects on function, as reconstitution into different membrane environments can alter properties

Altered Spectral Properties:

  • Confirm presence of chloride ions, as absorption spectra change from blue to purple upon chloride addition (Km value of approximately 1.7 mM)

  • Verify retinal isomer used for reconstitution, as different isomers may affect spectral properties

Disrupted Trimeric Assembly:

  • Check for mutations in regions critical for trimer formation, particularly near Ala165 which is located at the trimer interface

  • Use circular dichroism spectroscopy to verify proper trimeric assembly

Impaired Chloride Transport:

  • Examine key residues like Ser81 and Thr126, which are essential for maintaining chloride ions near the Schiff base

  • Verify integrity of the extracellular part of helix D, which undergoes significant conformational changes during ion transport

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.