Recombinant Natronomonas pharaonis Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB1; NP_0024A; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis)
Target Names
crcB1
Target Protein Sequence
MKPRAVALVAGGGFAGALCRHGIAVVLPGTFPWGTLVVNVAGAFLLGAIVYGTERLRSVP ESTRLVVATGFLSSFTTYSTFAGETIALAPRLAALNVVGNYALGFVAVLVAREVIRWRS
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing functional crcB1 protein?

E. coli has been demonstrated as an effective heterologous expression system for Natronomonas pharaonis crcB1 . When designing expression experiments, researchers should consider:

  • Expression vector selection with appropriate promoter strength

  • Fusion tag placement (N-terminal His-tag has been successfully utilized)

  • E. coli strain selection (BL21(DE3) or similar strains optimized for membrane protein expression)

  • Induction conditions (temperature, inducer concentration, induction time)

The documented successful expression in E. coli systems suggests that despite crcB1's archaeal origin, significant refolding or specialized archaeal expression systems may not be necessary . For functional studies, researchers should verify protein integrity post-expression through activity assays or structural validation.

What storage conditions maximize stability of purified crcB1 protein?

Based on empirical data for recombinant crcB1, the following storage guidelines maximize protein stability:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C or -80°CAliquoting is necessary to prevent degradation
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% TrehaloseCryoprotectants enhance stability
Protein concentration0.1-1.0 mg/mL after reconstitutionOptimal range for functional studies
Glycerol addition5-50% (final concentration)50% is standard for archaeal proteins
Working aliquots4°CStable for up to one week

Critical stability note: Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity . For reconstitution of lyophilized protein, researchers should briefly centrifuge vials before opening to ensure complete recovery of the protein sample .

How should researchers design experimental controls when studying crcB1 function?

When designing experiments to study crcB1 function, particularly its putative role as a fluoride ion transporter, researchers should implement a comprehensive control strategy:

  • Experimental Control (Standard of Comparison):

    • Include an unaltered baseline condition as the standard of comparison

    • The standard should represent "normal" physiological conditions for the protein

    • Design the standard to either support or refute the experimental hypothesis

  • Controlled Variables:

    • Identify at least 3 relevant variables that could affect experimental outcomes

    • Document how these variables will be kept constant throughout the experiment

    • Examples include buffer composition, temperature, pH, and protein concentration

  • Negative Controls:

    • Heat-denatured crcB1 to demonstrate specificity of transport function

    • Buffer-only systems lacking protein to establish baseline measurements

    • Non-functional mutant variants (if available) to confirm structure-function relationships

This control framework follows established experimental design principles in protein research and ensures that observed effects can be specifically attributed to crcB1 function .

What methodological approaches can detect and quantify crcB1's putative fluoride transport activity?

To investigate crcB1's putative fluoride ion transport activity, researchers should consider these methodological approaches:

  • Liposome Reconstitution Assays:

    • Reconstitute purified crcB1 into proteoliposomes

    • Use fluoride-sensitive probes (e.g., PBFI for indirect detection)

    • Monitor fluoride flux using spectrofluorometric techniques

    • Compare transport rates between proteoliposomes with and without crcB1

  • Electrophysiological Measurements:

    • Patch-clamp recording of crcB1-expressing cells or artificial membranes

    • Planar lipid bilayer recordings with reconstituted protein

    • Ion selectivity determination using bi-ionic potential measurements

  • Fluoride Binding Studies:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Microscale thermophoresis to detect conformational changes upon fluoride binding

    • Competition assays with other halides to determine specificity

When analyzing results, researchers should calculate transport rates using at least three replicate measurements for statistical validity . Data should be presented with appropriate error analysis and significance testing.

How can researchers distinguish between functional and structural effects when characterizing crcB1 mutations?

When characterizing the effects of mutations on crcB1 function, researchers must employ a systematic approach to differentiate between direct functional impacts and indirect structural consequences:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes

    • Thermal stability assays to detect folding defects

    • Limited proteolysis to assess conformational changes

    • Size exclusion chromatography to confirm proper oligomeric state

  • Functional Characterization:

    • Transport assays under standardized conditions

    • Binding affinity measurements for fluoride and potential ligands

    • Kinetic analysis (comparing Km and Vmax parameters)

  • Correlation Analysis:

    • Plot structural parameters against functional measurements

    • Perform multivariate analysis to identify patterns

    • Use proper controls (conservative vs. non-conservative mutations)

This approach ensures that functional deficits observed in mutant proteins are not simply due to protein misfolding or instability, a critical distinction in structure-function studies of membrane transporters.

What purification strategy yields the highest purity of functional crcB1?

For optimal purification of His-tagged recombinant crcB1, the following methodology is recommended:

  • Cell Lysis Protocol:

    • Resuspend E. coli cells in lysis buffer containing protease inhibitors

    • Disrupt cells via sonication or French press

    • Remove cellular debris by centrifugation (10,000 × g, 20 min)

    • Collect membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Protein Extraction:

    • Solubilize membrane fraction with appropriate detergent (e.g., DDM, LDAO)

    • Incubate with gentle rotation (4°C, 1-2 hours)

    • Remove insoluble material by centrifugation (100,000 × g, 30 min)

  • Affinity Chromatography:

    • Apply solubilized protein to Ni-NTA or similar affinity resin

    • Wash with increasing imidazole concentrations to remove non-specific binding

    • Elute crcB1 with high imidazole buffer (250-300 mM)

  • Quality Control:

    • Assess purity by SDS-PAGE (expect >90% purity)

    • Verify identity by Western blot or mass spectrometry

    • Confirm proper folding by functional assays

This purification approach has been validated to yield crcB1 protein with greater than 90% purity as determined by SDS-PAGE analysis .

How should researchers design experiments to investigate crcB1's role in halophilic adaptation?

To investigate crcB1's potential role in halophilic adaptation in Natronomonas pharaonis, a structured experimental approach should be implemented:

  • Comparative Expression Analysis:

    • Design experiments comparing crcB1 expression levels under varying salt concentrations

    • Use qRT-PCR to quantify transcript levels

    • Complement with proteomic analysis to confirm protein expression changes

    • Include proper reference genes for normalization

  • Functional Assessment Under Salt Stress:

    • Measure fluoride transport activity at different salt concentrations (0.5-4.5 M NaCl)

    • Determine kinetic parameters (Km, Vmax) under varying ionic strength

    • Assess protein stability using thermal shift assays at different salt concentrations

  • Genetic Manipulation Approaches:

    • Generate knockout or knockdown models (if genetic tools are available for N. pharaonis)

    • Perform complementation studies

    • Heterologous expression in non-halophilic organisms to assess salt tolerance

  • Variables and Controls:

    • Independent Variable: Salt concentration (NaCl)

    • Dependent Variable: Transport activity, expression level, or growth rate

    • Controlled Variables: pH, temperature, buffer composition

    • Standard of Comparison: Optimal growth salt concentration for N. pharaonis

This systematic approach follows established principles in experimental design for studying extremophilic adaptation mechanisms .

What analytical techniques can determine the membrane topology of crcB1?

To determine the membrane topology of crcB1, researchers should employ complementary analytical techniques:

  • Computational Prediction Methods:

    • Hydropathy analysis using multiple algorithms (TMHMM, HMMTOP)

    • Topology prediction software specific for membrane proteins

    • Comparative analysis with CrcB homologs of known topology

  • Biochemical Approaches:

    • Cysteine scanning mutagenesis with thiol-reactive probes

    • Protease protection assays

    • Glycosylation mapping (in eukaryotic expression systems)

  • Structural Biology Methods:

    • Cryo-electron microscopy of purified protein in nanodiscs

    • X-ray crystallography (challenging for membrane proteins)

    • Solid-state NMR spectroscopy

  • Experimental Design Considerations:

    • Generate a comprehensive dataset using multiple approaches

    • Include positive and negative controls for each method

    • Perform at least three independent replications of each experiment

    • Analyze data statistically to assess confidence in topology model

This multi-faceted approach provides robust evidence for membrane protein topology determination, crucial for understanding structure-function relationships in transporters like crcB1.

How can researchers troubleshoot poor expression of recombinant crcB1?

When facing challenges with recombinant crcB1 expression, researchers should implement this structured troubleshooting approach:

IssuePotential CausesTroubleshooting StepsExpected Outcome
Low expression yieldCodon biasUse codon-optimized sequence for E. coli2-5 fold increase in expression
Toxicity to hostUse tightly regulated promoter systemsReduced toxicity, higher cell density
Protein degradationAdd protease inhibitors, use protease-deficient strainsIncreased recovery of intact protein
Insoluble proteinImproper foldingLower induction temperature (16-20°C)Improved solubility
Insufficient detergentScreen multiple detergent types and concentrationsOptimal extraction efficiency
Inactive proteinImproper foldingInclude molecular chaperonesEnhanced functional yield
Missing cofactorsSupplement growth media with potential cofactorsIncreased specific activity

This methodical approach addresses the most common issues encountered in heterologous expression of archaeal membrane proteins like crcB1 .

What statistical approaches are appropriate for analyzing crcB1 transport activity data?

When analyzing experimental data from crcB1 transport studies, researchers should implement appropriate statistical methods:

  • Preliminary Data Analysis:

    • Calculate mean, standard deviation, and standard error for each experimental condition

    • Perform normality tests (Shapiro-Wilk or Kolmogorov-Smirnov)

    • Generate box plots to visualize data distribution and identify outliers

  • Comparative Analysis:

    • For normally distributed data: t-tests (two conditions) or ANOVA (multiple conditions)

    • For non-normally distributed data: Mann-Whitney U test or Kruskal-Wallis test

    • Post-hoc tests: Tukey's HSD or Dunn's test with appropriate corrections

  • Kinetic Data Analysis:

    • Fit transport data to appropriate kinetic models (Michaelis-Menten, Hill equation)

    • Use non-linear regression with iterative fitting

    • Calculate confidence intervals for kinetic parameters

  • Experimental Design Considerations:

    • Perform power analysis to determine appropriate sample size

    • Include at least three independent replications per condition

    • Use randomization and blinding where applicable

How can researchers validate the physiological relevance of in vitro findings for crcB1?

To establish the physiological relevance of in vitro findings for crcB1, researchers should implement a comprehensive validation strategy:

  • Correlation with Native Environment Conditions:

    • Test protein function across the pH range found in N. pharaonis natural habitat

    • Evaluate activity under physiologically relevant salt concentrations (3.0-3.5 M NaCl)

    • Determine temperature dependence corresponding to optimal growth temperatures

  • Comparative Analysis:

    • Compare crcB1 properties with homologs from related halophilic archaea

    • Establish evolutionary conservation patterns for key functional residues

    • Correlate transport properties with ecological niches of source organisms

  • Cellular Context Validation:

    • Develop assays in membrane vesicles from native organisms

    • Employ genetic approaches (if available) in N. pharaonis

    • Use heterologous expression in model organisms with defined genetic backgrounds

  • Experimental Controls:

    • Include appropriate negative controls (heat-denatured protein, transport-deficient mutants)

    • Use positive controls (well-characterized transporters)

    • Standard of comparison: baseline conditions representing native environment

This methodological approach bridges the gap between in vitro biochemical findings and physiological relevance within the native extremophilic context .

How can structural biology approaches enhance understanding of crcB1 function?

Structural biology offers powerful approaches to elucidate crcB1 function through these methodological strategies:

This comprehensive structural biology approach can reveal mechanistic insights into crcB1's fluoride transport mechanism that are unattainable through functional studies alone.

What approaches can identify potential interacting partners of crcB1 in Natronomonas pharaonis?

To identify protein-protein interactions involving crcB1, researchers should implement these complementary methodological approaches:

  • Affinity-Based Methods:

    • Pull-down assays using tagged crcB1 as bait

    • Co-immunoprecipitation with antibodies against crcB1

    • Sample analysis by mass spectrometry to identify binding partners

    • Validation with reciprocal pull-downs

  • Proximity-Based Approaches:

    • In vivo crosslinking in native N. pharaonis

    • BioID or APEX2 proximity labeling (if genetic tools are available)

    • Split reporter systems (bacterial two-hybrid) for candidate interactions

  • Bioinformatic Prediction:

    • Genomic context analysis (gene neighborhood, operons)

    • Co-evolution analysis to identify potentially interacting proteins

    • Protein-protein interaction network prediction using archaeal databases

  • Functional Validation:

    • Co-purification studies to confirm stable complexes

    • Functional assays comparing crcB1 alone versus in complex

    • Mutagenesis of predicted interaction interfaces

This systematic approach can reveal previously unknown protein-protein interactions that may regulate crcB1 function or connect it to broader cellular processes in this extremophilic archaeon.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.