Recombinant Natronomonas pharaonis Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer preference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB2; NP_0026A; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis)
Target Names
crcB2
Target Protein Sequence
MALLTALAVGAGGAAGAVARYAVGLSVGRRAVDTGLVNVFGSLLFGVAIGADFGGAPAVA VTVGFCGAFTTFSSFAVETVRLAEDGQRLAAAGNAVGTLAAALLAVFLGIALGAAL
Uniprot No.

Target Background

Function

Important for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Natronomonas pharaonis CrcB homolog 2 (crcB2) protein and what is its function?

Natronomonas pharaonis CrcB homolog 2 (crcB2) is a membrane protein encoded by the crcB2 gene (also known as NP_RS00070) in the haloalkaliphilic archaeon Natronomonas pharaonis . This protein is annotated as a putative fluoride ion transporter and belongs to a family of proteins that mediate ion transport across cellular membranes.

Natronomonas pharaonis is an extremophile isolated from salt-saturated alkaline lakes with pH values around 11, growing optimally in 3.5 M NaCl and at pH 8.5 . The organism has evolved specialized adaptations to cope with these extreme environmental conditions. As a putative fluoride ion transporter, CrcB2 likely plays a crucial role in maintaining ionic homeostasis by regulating fluoride concentrations within the cell, as excessive fluoride can inhibit metabolic enzymes.

What are the optimal storage conditions for recombinant Natronomonas pharaonis CrcB2 protein?

Based on standard protocols for similar recombinant proteins, optimal storage conditions include:

Storage FormTemperatureTime PeriodAdditional Recommendations
Lyophilized powder−20°C/−80°CLong-termStore in original container with desiccant
Reconstituted protein4°CUp to one weekWorking aliquots only
Reconstituted with glycerol−20°C/−80°CLong-termAdd glycerol to 50% final concentration

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Repeated freeze-thaw cycles should be avoided, making aliquoting essential for multiple-use scenarios. For long-term storage after reconstitution, adding glycerol (5-50%, with 50% being optimal) is recommended before storing at −20°C or −80°C .

How is recombinant Natronomonas pharaonis CrcB2 protein typically expressed and purified?

The expression and purification process typically follows this methodological approach:

Expression:

  • Host system: E. coli (typically BL21(DE3) strain)

  • Fusion tag: N-terminal His-tag for affinity purification

  • Expression construct: Full-length protein (119 amino acids)

  • Induction conditions: Optimized temperature, IPTG concentration, and duration

Purification workflow:

  • Bacterial cell lysis (sonication or French press)

  • Clarification of lysate by centrifugation

  • Initial capture using Ni-NTA affinity chromatography

  • Washing with increasing imidazole concentrations to remove non-specific binding

  • Elution with high imidazole concentration

  • Buffer exchange to remove imidazole

  • Optional: Secondary purification using size exclusion chromatography

  • Quality assessment by SDS-PAGE (≥85-90% purity)

  • Concentration determination

  • Lyophilization in stabilizing buffer

For membrane proteins like CrcB2, additional considerations include the use of appropriate detergents throughout the purification process to maintain protein solubility and structural integrity.

What are the recommended reconstitution protocols for lyophilized recombinant Natronomonas pharaonis CrcB2?

For optimal reconstitution of lyophilized CrcB2 protein:

Basic reconstitution:

  • Centrifuge the vial briefly to collect the lyophilized powder at the bottom

  • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Allow complete rehydration by gentle mixing (avoid vigorous vortexing)

  • For long-term storage, add glycerol to a final concentration of 5-50%

For functional studies in artificial membrane systems:

StepProcedureRationale
1Select appropriate detergent (e.g., DDM, LDAO)Maintains protein solubility
2Prepare liposomes with archaeal-like lipid compositionMimics native membrane environment
3Mix solubilized protein with liposomesInitiates membrane incorporation
4Remove detergent via dialysis or Bio-BeadsAllows protein to integrate into bilayer
5Verify incorporation by density gradient centrifugationConfirms successful reconstitution

For fluoride transport studies, liposomes can be loaded with fluoride-sensitive probes before protein incorporation, enabling functional assessment via spectrofluorometry upon addition of external fluoride.

How can I assess the purity and functionality of recombinant Natronomonas pharaonis CrcB2 protein?

Purity assessment methods:

Functionality assessment for ion transporters:

  • Liposome-based ion flux assays:

    • Reconstitute CrcB2 into liposomes

    • Monitor fluoride transport using ion-selective electrodes or fluorescent indicators

    • Compare transport rates to negative controls (protein-free liposomes)

  • Electrophysiological approaches:

    • Incorporate protein into planar lipid bilayers

    • Measure ion currents using patch-clamp techniques

    • Characterize conductance, selectivity, and gating properties

  • Binding assays:

    • Thermal shift assays to detect stabilization upon fluoride binding

    • Isothermal titration calorimetry to determine binding affinities

    • Surface plasmon resonance to measure binding kinetics

These complementary approaches provide a comprehensive assessment of both the physical quality and functional activity of the recombinant protein.

How does Natronomonas pharaonis CrcB2 compare to CrcB homologs in other archaeal and bacterial species?

Comparing CrcB homologs across species reveals interesting insights about evolutionary conservation and functional specialization:

SpeciesProteinLength (aa)AnnotationReference
Natronomonas pharaonisCrcB1119Putative fluoride ion transporter
Natronomonas pharaonisCrcB2UnknownPutative fluoride ion transporter
Bacillus cereusCrcB2118Putative fluoride ion transporter
Staphylococcus aureusCrcB2UnknownCamphor resistance protein
Deinococcus geothermalisCrcB2UnknownChromosome condensation protein

While all these proteins belong to the CrcB family, their diverse annotations suggest potential functional divergence or incomplete characterization. The fluoride transport function appears to be the most consistently recognized role.

Natronomonas pharaonis is particularly interesting as it possesses two CrcB homologs (CrcB1 and CrcB2), which may reflect functional specialization or redundancy for survival in extreme environments. The presence of both proteins might allow for differential regulation or localization, contributing to the organism's remarkable adaptability to high salt and alkaline conditions .

Further comparative analysis would require multiple sequence alignments, structural modeling, and functional characterization across different species to identify conserved motifs and species-specific adaptations.

How can I design experiments to investigate the role of Natronomonas pharaonis CrcB2 in fluoride ion transport?

A comprehensive experimental approach would include:

In vitro transport assays:

  • Liposome-based fluoride flux assays:

    • Reconstitute purified CrcB2 into liposomes

    • Internal fluoride detection using PBFI (potassium-binding benzofuran isophthalate) adapted for fluoride sensitivity

    • Measure fluorescence changes upon establishing fluoride gradients

    • Control experiments: protein-free liposomes and heat-inactivated protein

  • Electrophysiological characterization:

    • Single-channel recordings in planar lipid bilayers

    • Whole-cell patch-clamp after heterologous expression

    • Ion selectivity profiling (comparing F-, Cl-, other anions)

    • Effect of pH and salt concentration on transport kinetics

Structure-function analysis:

ApproachMethodologyExpected Outcome
Site-directed mutagenesisModify conserved residuesIdentify essential amino acids for transport
Chimeric constructsDomain swapping with CrcB1Map functional domains
Topology mappingCysteine accessibility methodsDetermine membrane orientation
Structural studiesX-ray crystallography or Cryo-EMVisualize transport mechanism

In vivo functional studies:

  • Heterologous expression:

    • Express in E. coli strains sensitive to fluoride

    • Assess growth in fluoride-containing media

    • Measure intracellular fluoride levels

  • Genetic manipulation in Natronomonas:

    • Generate crcB2 knockout using methods similar to those used for nos gene deletion

    • Assess phenotypic changes in fluoride tolerance

    • Perform complementation studies with wild-type and mutant versions

  • Physiological characterization:

    • Examine expression levels under different fluoride concentrations

    • Assess impact of environmental pH and salinity on function

    • Investigate potential regulation mechanisms

This multi-faceted approach would provide comprehensive insights into the molecular mechanism and physiological significance of fluoride transport by CrcB2 in Natronomonas pharaonis.

What genetic manipulation techniques are available for studying crcB2 function in Natronomonas pharaonis?

Recent advances in genetic tools for Natronomonas pharaonis provide several approaches for studying crcB2 function:

Gene inactivation strategies:

  • Homologous recombination-based approach:

    • Successfully implemented for nos gene disruption in Natronomonas pharaonis

    • Requires:

      • Homology arms flanking crcB2

      • Selectable marker (e.g., novobiocin resistance via gyrB)

      • Optimized transformation protocol adapted from Natrialba magadii methods

  • CRISPR-Cas9 systems:

    • Emerging tools for haloarchaea

    • Design considerations for high-GC genome (63.4% GC)

    • PAM site identification within crcB2

Verification methods:

MethodApplicationNotes
PCR screeningInitial mutant identificationDesign primers spanning integration site
Southern blottingConfirm genomic alterationsUseful for complex rearrangements
Genome resequencingComprehensive verificationCan identify off-target mutations
RT-qPCRConfirm transcript absenceValidate knockout at RNA level

Complementation and expression systems:

  • Plasmid-based expression:

    • Using native promoters or inducible systems

    • Addition of epitope tags for detection

    • Site-directed mutagenesis for structure-function studies

  • Genomic reintegration:

    • Precise replacement at native locus

    • Single-copy expression under native regulation

Challenges and considerations:

  • Growth requirements for genetic work with Natronomonas pharaonis:

    • High salt media (3.5 M NaCl optimal)

    • Alkaline pH (pH 8.5 optimal)

    • Specialized incubation equipment

  • Potential issues identified in previous genetic studies:

    • Accumulation of secondary mutations during manipulation

    • Need for improved counterselection systems

    • Limited genetic tools compared to model organisms

These genetic approaches would enable detailed investigation of crcB2 function in its native archaeal context, providing insights beyond heterologous expression systems.

How does the extreme environment of Natronomonas pharaonis affect the structure and function of its CrcB proteins?

Natronomonas pharaonis thrives in environments that would be lethal to most organisms, growing optimally at 3.5 M NaCl and pH 8.5 . These extreme conditions have driven remarkable adaptations in its proteins, including membrane transporters like CrcB2:

Adaptations to high salinity (halophilic adaptations):

  • Protein sequence characteristics:

    • Increased acidic residue content (Asp, Glu) on protein surface

    • Reduced hydrophobic amino acids exposed to solvent

    • Enhanced negative surface charge for hydration shell formation

  • Structural stabilization mechanisms:

    • Extensive salt bridge networks

    • Increased intra-protein ion binding sites

    • Modified hydrophobic core packing

Adaptations to high pH (alkaliphilic adaptations):

FeatureAdaptationFunctional Impact
Surface residuesAltered pKa valuesMaintains function at high pH
Active siteModified charge distributionPreserves catalytic activity
Ion coordinationSpecialized binding geometryMaintains transport specificity
Protein foldingEnhanced stability against alkaline denaturationExtends protein lifespan

Membrane-specific adaptations:

  • Lipid interactions:

    • Archaeal isoprenoid-based lipids rather than fatty acids

    • Modified protein-lipid interface

    • Specialized anchoring mechanisms

  • Transport mechanism adaptations:

    • Potentially altered ion coupling (Na+ vs H+)

    • Modified gating mechanisms

    • Specialized selectivity filters

The genome sequence of Natronomonas pharaonis reveals adaptations for coping with ammonia and heavy metal deficiencies that arise at high pH values . The organism also shows a high degree of nutritional self-sufficiency and contains specialized membrane proteins with alkaline-resistant lipid anchors .

For CrcB proteins specifically, these extreme conditions likely necessitate specialized structural features to maintain functional fluoride transport while preventing protein denaturation. Experimental approaches to study these adaptations would include comparative structural analysis with mesophilic homologs, stability measurements across pH and salt gradients, and transport assays under varying environmental conditions.

What are the challenges in crystallizing membrane proteins like Natronomonas pharaonis CrcB2 and how can they be overcome?

Membrane proteins present significant crystallization challenges, especially those from extremophiles like Natronomonas pharaonis. Drawing from approaches used for other challenging membrane proteins , the following strategies can be employed:

Key challenges:

  • Intrinsic factors:

    • Amphipathic nature (hydrophobic transmembrane regions, hydrophilic domains)

    • Conformational heterogeneity

    • Limited polar surface area for crystal contacts

    • Instability when removed from native membrane environment

  • Technical factors:

    • Detergent micelles obscuring crystal contacts

    • Low expression yields

    • Purification difficulties

    • Limited crystallization space

Systematic construct optimization:

Based on successful approaches with other proteins , a rational design strategy would include:

Design StrategyImplementationExample
Multiple construct designCreate 10-15 variants with different boundariesVarying N- and C-termini
Domain removalDelete flexible or non-essential domainsRemoval of disordered regions
Fusion partnersAdd crystallization-promoting proteinsT4 lysozyme fusion
Stabilizing mutationsIntroduce disulfide bonds or surface mutationsStrategic residue substitutions
Surface engineeringModify surface residues to promote crystal contactsEntropy reduction

Advanced crystallization methods:

  • Membrane mimetic approaches:

    • Lipidic cubic phase crystallization

    • Bicelle crystallization

    • Nanodisc incorporation

  • Crystal optimization:

    • Microseeding techniques

    • Additive screening

    • Controlled dehydration

    • Crystallization chaperones (antibody fragments, nanobodies)

  • Alternative solubilization strategies:

    • Novel detergents (maltose-neopentyl glycol detergents)

    • Amphipols

    • Styrene-maleic acid lipid particles (SMALPs)

Data collection considerations:

  • Microfocus beamlines for small crystals

  • Serial crystallography approaches

  • Room-temperature data collection

The successful crystallization strategy would likely require iterative optimization and parallel pursuits of multiple approaches. The CRBNmidi approach described in search result , where researchers systematically tested 15 different constructs to identify one with superior crystallization properties, exemplifies the type of thorough approach needed for challenging membrane proteins like Natronomonas pharaonis CrcB2.

How should I design data tables for CrcB2 transport assays?

When designing experiments to study CrcB2 transport activity, proper data table formatting is essential. Following standard scientific practices3 :

Example Table 1: Fluoride Transport Activity Under Various pH Conditions

pH Value (Independent Variable)Fluoride Transport Rate (nmol/min/mg protein) (Dependent Variable)
Trial 1Trial 2
6.512.3
7.518.6
8.525.7
9.520.3
10.515.1

Example Table 2: Effect of Site-Directed Mutations on CrcB2 Transport Activity

Protein VariantRelative Transport Activity (%)Protein Expression Level (%)Membrane Localization
Wild-type CrcB2100 ± 5100 ± 8+++
R45A85 ± 795 ± 6+++
E78A45 ± 690 ± 7+++
S102A93 ± 498 ± 5+++
G34L12 ± 370 ± 9++
F55A<585 ± 7++

Key principles for effective data table design include:

  • Place independent variables in the left column and dependent variables in right columns

  • Include multiple trials to establish reproducibility

  • Calculate and display mean values and standard deviations

  • Organize data from smallest to largest (or vice versa) to reveal trends

  • Use consistent units and clearly label all variables

  • Include all controlled variables in the table title or notes

What comparative analyses can be performed between CrcB1 and CrcB2 from Natronomonas pharaonis?

A comprehensive comparison between the two CrcB homologs would include:

Sequence and structural comparison:

FeatureCrcB1CrcB2Methodology
Amino acid sequenceMKPRAVALVAGGGFAGALCRHGIAVVLPGTFPWGTLVVNVAGAFLLGAIVYGTERLRSVP ESTRLVVATGFLSSFTTYSTFAGETIALAPRLAALNVVGNYALGFVAVLVAREVIRWRS Not provided in search resultsMultiple sequence alignment
Sequence length119 amino acids Likely similar to CrcB1Sequence analysis
Predicted transmembrane domainsNumber and positionsNumber and positionsHydropathy analysis
Conserved motifsIdentify key functional regionsIdentify key functional regionsMotif analysis
Homology modelsPredicted tertiary structurePredicted tertiary structureComputational modeling

Functional characterization:

ParameterCrcB1CrcB2
Ion selectivityFluoride vs. other ionsFluoride vs. other ions
Transport kineticsKm, Vmax valuesKm, Vmax values
pH optimumActivity profile across pH rangeActivity profile across pH range
Salt dependenceActivity at different salt concentrationsActivity at different salt concentrations
Inhibitor sensitivityResponse to known channel blockersResponse to known channel blockers

Expression and regulation:

  • Transcriptomic analysis:

    • mRNA levels under different conditions

    • Co-expression patterns

    • Response to environmental stressors

  • Proteomic analysis:

    • Protein abundance in different growth phases

    • Post-translational modifications

    • Protein-protein interactions

  • Localization studies:

    • Subcellular distribution

    • Membrane domain association

    • Oligomerization state

This systematic comparison would provide insights into the potentially distinct roles of these two homologs in fluoride homeostasis and reveal how gene duplication may have contributed to the remarkable adaptability of Natronomonas pharaonis to extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.