Recombinant Natronomonas pharaonis Sensory rhodopsin-2 (sop2)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism and Photocycle

SR-2 activates a photophobic response in archaea by detecting blue-green light (480–500 nm), triggering a conformational shift that signals flagellar motion via its transducer, HtrII . The photocycle involves sequential intermediates:

IntermediateKey FeaturesResearch Findings
BR (Ground State)Retinal in all-trans configurationStable in darkness; absorbs blue-green light
KRetinal isomerization to 13-cis form; water cluster rearrangementObserved via X-ray crystallography (PDB: 2F93)
LProton transfer to cytoplasmic sideLimited characterization; precedes M-state formation
M (Late M)Helix F/G rearrangement; transducer binding site exposedCorrelates with signal transduction; HtrII TM2 helix rotates 15°
ORetinal re-isomerization; proton releaseAbsent in some SR-2 variants; photopumping activity observed without HtrII

The photocycle differs from bacteriorhodopsin (BR) in lacking a distinct N intermediate .

Research Applications

SR-2 is widely used in biophysical studies due to its stability and functional versatility:

ApplicationDetailsReferences
Membrane Protein CrystallizationControl for assessing crystallization conditions; high purity ensures reproducibility
Signal Transduction StudiesInvestigating HtrII interaction kinetics; TR-EPR and transient grating methods reveal volume changes
Proton Pumping AnalysisFunctional characterization in lipid bilayers; compared to bacteriorhodopsin
Structural BiologyX-ray/NMR studies of photocycle intermediates; helical dynamics elucidated

Key Research Findings

  1. Transducer Influence: HtrII binding stabilizes SR-2’s early intermediates and induces additional volume changes during signal transduction .

  2. Proton Pumping: In the absence of HtrII, SR-2 functions as a light-driven proton pump, with helix F/G rearrangements driving proton release .

  3. Conformational Dynamics: TR-EPR studies show cytoplasmic helices (B, C, F, G) undergo structural shifts upon light activation, critical for transducer interaction .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
sop2; sopII; Sensory rhodopsin-2; Sensory rhodopsin II; SR-II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-239
Protein Length
full length protein
Species
Natronomonas pharaonis (Natronobacterium pharaonis)
Target Names
sop2
Target Protein Sequence
MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGW VPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPG IERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLL GPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGESLAGVDTDAPAVAD
Uniprot No.

Target Background

Function

Photophobic photoreceptor responsible for negative phototaxis. Activates the sensory rhodopsin II transducer (HTR-II) in response to blue light.

Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Natronomonas pharaonis Sensory Rhodopsin-2?

Sensory rhodopsin-2 (SR-2, NpSRII) is a seven-transmembrane helical retinal protein that functions as a photoreceptor protein mediating negative phototaxis in halophilic archaea, particularly Natronomonas pharaonis . It belongs to the microbial rhodopsin family and serves as a phototaxis receptor that allows these organisms to move away from potentially harmful blue-green light. The protein contains a retinal chromophore covalently bound to a lysine residue (K205) via a Schiff base linkage . NpSRII is also referred to as pharaonis phoborhodopsin (ppR) in some scientific literature .

What spectroscopic properties characterize NpSRII?

NpSRII exhibits distinctive spectroscopic characteristics that are crucial for monitoring its function and photocycle:

Spectroscopic ParameterValueNotes
Extinction coefficient (500 nm)45,500 M⁻¹cm⁻¹For dark-adapted state
Extinction coefficient (590 nm)54,000 M⁻¹cm⁻¹For photoactivated state
Absorbance ratio (280/500 nm)2.8Used for purity assessment
Maximum absorption~498 nmGround state

The protein undergoes a photocycle upon light activation, with several spectrally distinct intermediates (K, L, M, N, O) that can be monitored spectroscopically . The photocycle is similar to that of bacteriorhodopsin (BR) but with significant differences in intermediate lifetimes, particularly for the M and O states .

What are the optimal conditions for recombinant expression of NpSRII?

Recombinant NpSRII can be functionally expressed in Escherichia coli cell membranes, which represents a significant advantage for structural and functional studies . For successful expression, researchers should consider the following methodology:

  • Clone the NpSRII gene into an expression vector with a strong promoter (T7 or similar)

  • Transform into an E. coli expression strain (commonly BL21(DE3) or derivatives)

  • Grow cultures at 30-37°C until mid-log phase

  • Induce with IPTG (typically 0.5-1 mM)

  • Supplement with all-trans retinal (5-10 μM) during induction to ensure proper chromophore incorporation

  • Continue expression at reduced temperature (25-30°C) for 4-6 hours or overnight

  • Harvest cells by centrifugation

The protein's stability under various conditions allows for versatile expression strategies, though careful optimization of temperature, induction time, and retinal supplementation is necessary for maximum functional protein yield .

How can pure, functional NpSRII be isolated from E. coli?

Purification of recombinant NpSRII requires specific approaches to maintain protein stability and functionality:

  • Cell lysis using mechanical disruption (French press or sonication) in appropriate buffer (typically containing 4M NaCl, 50 mM MES at pH 6.0)

  • Membrane isolation by ultracentrifugation

  • Solubilization using mild detergents (0.03% dodecyl maltoside (DDM) is commonly employed)

  • Affinity chromatography using Ni-NTA agarose for His-tagged protein

  • Size exclusion chromatography for final polishing

  • Buffer exchange to storage buffer (4 M NaCl, 50 mM MES pH 6.0, 0.03% DDM)

Quality assessment should include SDS-PAGE analysis for purity (>98% is achievable), UV-Vis spectroscopy (A280/A500 ratio of approximately 2.8), and functional assays to confirm photocycle activity .

How does the photocycle of NpSRII compare to other microbial rhodopsins?

The NpSRII photocycle shares similarities with bacteriorhodopsin (BR) but displays significant differences in intermediate kinetics:

IntermediateNpSRII LifetimeBR LifetimeKey Differences
KMicrosecondsMicrosecondsSimilar kinetics
LMillisecondsMillisecondsSimilar kinetics
MHundreds of msMillisecondsMuch slower in NpSRII
NNot well-characterizedMillisecondsLimited evidence in NpSRII
OSecondsMillisecondsMuch slower in NpSRII

The photocycle of NpSRII follows the sequence: NpSRII → K → L → M → O → NpSRII, with the N intermediate being less pronounced compared to BR . The extended lifetimes of M and O intermediates result in a significantly slower photocycle turnover rate compared to BR . This slower kinetics is functionally important, as it provides sufficient time for signal transduction to the associated transducer protein HtrII .

What is the role of specific amino acid residues in NpSRII function?

Several key amino acid residues are critical for NpSRII function:

  • Lysine 205 (K205): Forms the Schiff base linkage with retinal

  • Tyrosine 199 (Y199): Located on the protein surface, responsible for binding to the transducer protein HtrII

  • Arginine 72 (R72): Influences the pKa of the Schiff base counterion and connects proton transfer events occurring at both the Schiff base and extracellular proton-releasing residue (Asp-193)

  • Aspartic acid 75 (D75): Serves as a proton acceptor during the photocycle

  • Aspartic acid 193 (D193): Functions as an extracellular proton-releasing residue

Research has shown that mutations of these residues significantly impact photocycle kinetics. For example, the L40T/F86D mutant exhibits M decay rates comparable to BR, indicating these residues' importance in regulating intermediate lifetimes . Similarly, mutations of R72 result in 8-27 fold faster M-decay rates at pH 8, suggesting this residue prevents proton transfer from an unidentified source to the Schiff base .

How can NpSRII serve as a model system for studying membrane protein structure?

NpSRII represents an excellent model system for studying membrane protein structures for several reasons:

  • It can be functionally expressed in E. coli at levels sufficient for structural studies

  • It maintains stability in various detergents and membrane mimetics

  • It has been successfully characterized by multiple structural biology techniques, including X-ray crystallography and NMR spectroscopy

  • Its relatively small size (246 amino acids) makes it amenable to various biophysical studies

Notably, NpSRII was the first detergent-solubilized seven-helical transmembrane protein to have its structure determined by NMR, serving as a proof of principle that such complex membrane proteins could be studied in solution . Studies comparing its structure in detergent micelles versus more native-like phospholipid bicelles have shown minimal environment-specific effects when using mild detergents, suggesting findings in detergent systems may translate well to more physiological contexts .

What methods are most effective for studying NpSRII photocycle kinetics?

Several complementary techniques are employed to characterize the NpSRII photocycle:

  • Time-resolved UV-visible spectroscopy: Tracks the formation and decay of intermediates based on their distinct absorption maxima

  • Flash photolysis: Monitors transient species following short light pulses

  • FTIR (Fourier-transform infrared) spectroscopy: Provides information about protein structural changes during the photocycle

  • Stopped-flow spectroscopy: Useful for studying pH-jump induced deprotonation events, such as D75 deprotonation

  • Pressure-perturbation methods: Reveals volume changes associated with intermediate transitions and helps distinguish mechanistic differences between rhodopsins

For comprehensive analysis, researchers often employ global fitting analysis of spectroscopic data to deconvolute overlapping intermediates and determine rate constants . This approach revealed that the apparent N intermediate of NpSRII exists in equilibrium with the more pronounced M and O states .

How does the NpSRII-HtrII complex formation affect signaling mechanisms?

The interaction between NpSRII and its transducer protein HtrII is crucial for phototaxis signaling:

  • HtrII consists of two transmembrane helices, two HAMP domains, and a methyl-accepting signaling domain

  • Y199 on NpSRII is a key residue facilitating complex formation with HtrII

  • Photon absorption induces structural changes in NpSRII that are transmitted to HtrII

  • These conformational changes in HtrII regulate cytoplasmic kinase activity, which in turn modulates flagellar rotation through phosphorylation

Understanding this protein-protein interaction is critical for elucidating signal transduction mechanisms in archaea. Research suggests that the extended lifetime of NpSRII photocycle intermediates, particularly M and O states, provides sufficient time for efficient signal transmission to HtrII . This represents a functional adaptation where slower photocycle kinetics actually enhance signaling efficiency.

What are the main challenges in working with recombinant NpSRII?

Researchers face several challenges when working with NpSRII:

  • Membrane protein expression: As a seven-transmembrane protein, expression levels can be limiting

  • Maintaining functionality: Ensuring proper folding and chromophore incorporation

  • Detergent compatibility: Finding conditions that maintain native structure

  • Photocycle analysis: Deconvoluting overlapping intermediates with complex kinetics

  • Protein-protein interactions: Reconstituting the NpSRII-HtrII complex in vitro

To address these challenges, several strategies have proven effective:

  • Optimizing expression conditions with careful temperature and induction control

  • Supplementing growth media with all-trans retinal during expression

  • Using mild detergents like DDM for extraction and purification

  • Employing multiple spectroscopic techniques in parallel for photocycle analysis

  • Testing protein function in both detergent micelles and phospholipid bicelles

How do environmental factors affect NpSRII stability and function?

NpSRII function is significantly influenced by environmental conditions:

Understanding these environmental dependencies is crucial for experimental design. For example, the pH-jump induced deprotonation of Asp75 in unphotolyzed NpSRII occurs with a time constant of 60 ms, which is at least 20 times slower than deprotonation of the equivalent Asp85 in BR . This suggests that proton transfer is slowed not only in the cytoplasmic channel but also in the extracellular channel of NpSRII .

How might NpSRII studies inform research on other seven-transmembrane proteins?

NpSRII serves as an important model system with implications for understanding other seven-transmembrane (7TM) proteins, including G protein-coupled receptors (GPCRs):

  • Methodological advances: Techniques developed for NpSRII structural determination may be adaptable to other challenging 7TM proteins

  • Protein dynamics: Insights into conformational changes during photocycle may inform understanding of activation mechanisms in other receptors

  • Signal transduction: The NpSRII-HtrII interaction provides a simpler model for studying receptor-transducer coupling

  • Structure-function relationships: Identification of key functional residues may reveal common principles across 7TM proteins

The successful NMR structure determination of NpSRII demonstrated that solution NMR studies are feasible for 7TM proteins, opening possibilities for similar approaches with GPCRs and other membrane receptors .

What mutational strategies might enhance NpSRII for optogenetic applications?

Engineering NpSRII for optogenetic applications represents an intriguing research direction:

  • Photocycle tuning: Mutations like L40T/F86D that accelerate M decay could be employed to create faster-cycling variants

  • Spectral tuning: Targeted mutations near the retinal binding pocket might shift absorption wavelengths

  • Signal coupling: Engineering chimeric proteins combining NpSRII's photosensitive domain with different signaling domains

  • Stability enhancement: Mutations improving expression and stability in mammalian systems

The exceptionally well-characterized photocycle of NpSRII provides a strong foundation for rational design approaches. Understanding how mutations like R72A affect proton transfer events and intermediate lifetimes provides mechanistic insights that could guide engineering efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.