Recombinant Nautilia profundicola Protein CrcB homolog (crcB)

What is the Recombinant Nautilia profundicola Protein CrcB homolog and what organism does it originate from?

The CrcB homolog is a protein encoded by the crcB gene in Nautilia profundicola, specifically strain ATCC BAA-1463 / DSM 18972 / AmH. Nautilia profundicola is a deep-sea hydrothermal vent bacterium belonging to the deepest branching lineage of the Epsilonproteobacteria . The recombinant version is artificially produced for research purposes while maintaining the structural and functional properties of the native protein. The protein consists of 128 amino acids with a specific sequence beginning with MKFDT and ending with KGIEAILK as identified in product specifications . This protein represents an important component for studying extremophile biology and potentially unique molecular mechanisms employed by organisms in hydrothermal vent ecosystems.

How does the structure of CrcB homolog relate to its potential function in Nautilia profundicola?

The CrcB homolog from N. profundicola features a transmembrane protein structure typical of the CrcB protein family. The amino acid sequence (MKFDTMLAIGIGGFIGAILRAYTAGLVNSAVKHDIPFGTLSVNLIGSLLLLGMFIGAIQYGGIQNPYIKSMLTTGMMGAFTFSTFAVESFFLFKNALYIQALSYILLNVIGCIILAGAGFKGIEAILK) suggests multiple hydrophobic regions consistent with membrane integration . While the specific function of CrcB in N. profundicola hasn't been directly studied, related CrcB proteins in other bacteria are associated with fluoride ion transport and resistance. The protein likely contributes to membrane integrity and ion homeostasis, which would be particularly important in the extreme conditions of deep-sea hydrothermal vents where N. profundicola thrives. Its potential involvement in the organism's unique nitrate metabolism pathways, such as the reverse-HURM pathway, remains an area for investigation .

What are the optimal storage and handling conditions for the Recombinant Nautilia profundicola CrcB protein to maintain its structural integrity?

For optimal storage and handling of Recombinant N. profundicola CrcB protein, researchers should adhere to the following protocol:

The protein should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein's stability . For long-term storage, maintain the protein at -20°C or -80°C for extended preservation . When working with the protein, researchers should avoid repeated freeze-thaw cycles as this significantly compromises structural integrity and functionality . Instead, prepare small working aliquots that can be stored at 4°C for up to one week .

Before each experiment, centrifuge the protein solution briefly to collect any precipitate that may have formed during storage. When designing experiments, consider that membrane proteins like CrcB often require special handling conditions compared to soluble proteins. For functional assays, incorporate appropriate detergents or lipid environments that mimic the native membrane context of the protein. Researchers should validate protein integrity before experiments using techniques such as SDS-PAGE, circular dichroism, or activity assays specific to membrane transport proteins.

How can researchers effectively incorporate recombinant CrcB into experimental systems to study nitrate metabolism pathways?

To effectively study nitrate metabolism pathways using recombinant CrcB, researchers should implement a multi-faceted approach:

First, establish expression systems that properly fold and insert this membrane protein into appropriate lipid bilayers. This may require specialized expression hosts optimized for membrane proteins. When designing experiments with N. profundicola CrcB, consider its potential contextual relationship with the reverse-HURM pathway components identified in N. profundicola . The protein may interact with components of this novel nitrate reduction pathway, which includes NAP (periplasmic nitrate reductase), HURM (hydroxylamine:ubiquinone redox module), and Har/Hcp (hydroxylamine reductase) .

Design reconstitution experiments where purified CrcB is incorporated into liposomes along with other components of the nitrate metabolism machinery. Use radioactively labeled nitrate or fluorescent analogs to trace transport activities across these artificial membranes. Complement these approaches with gene knockout/complementation studies in N. profundicola or heterologous expression in model organisms to assess how CrcB affects nitrate utilization under various growth conditions.

Researchers should monitor growth parameters, ammonium production, and intermediate metabolite formation (particularly hydroxylamine) when manipulating CrcB expression levels, as these were key indicators of nitrate metabolism in the original studies of N. profundicola .

What analytical techniques are most appropriate for investigating potential interactions between CrcB and other components of the reverse-HURM pathway?

To investigate interactions between CrcB and reverse-HURM pathway components, researchers should employ multiple complementary analytical techniques:

Co-immunoprecipitation (Co-IP) using antibodies against CrcB can identify protein-protein interactions with components of the reverse-HURM pathway. This should be performed under native conditions to preserve membrane protein interactions. Proximity labeling approaches such as BioID or APEX2 fused to CrcB can identify proteins that come into close proximity with CrcB in living cells, potentially revealing functional associations with nitrate metabolism machinery.

Researchers should consider fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) experiments with tagged versions of CrcB and putative interacting partners to monitor interactions in real-time within living cells. Bacterial two-hybrid systems adapted for membrane proteins can screen for potential binding partners from genomic libraries of N. profundicola.

For functional correlation studies, measure nitrate reduction rates and ammonium production in wild-type versus CrcB-modified cells, similar to the experiments performed for other components of the reverse-HURM pathway . Use quantitative real-time PCR to determine if CrcB expression changes in coordination with other genes involved in nitrate metabolism (napA, haoA, cycB/napC) when cells are grown under different nitrogen sources, as was demonstrated for other components of the pathway .

How does the expression profile of CrcB correlate with other genes involved in nitrate ammonification in Nautilia profundicola?

While the specific expression profile of CrcB in relation to nitrate ammonification has not been directly studied in N. profundicola, researchers can draw insights from related studies of the reverse-HURM pathway to design appropriate experiments. In N. profundicola, components of the reverse-HURM pathway showed significant upregulation when cells were grown with nitrate as compared to ammonium .

The nitrate reductase subunit (napA) exhibited a 4.6-fold increase in transcript abundance when cells were grown with nitrate+sulfide compared to ammonium+polysulfide . Other components of the pathway showed even greater increases: haoA (8.5-fold) and cycB/napC (7.1-fold) . Researchers investigating CrcB should design qRT-PCR experiments targeting crcB transcripts under similar growth conditions to determine if its expression correlates with these known nitrate metabolism genes.

If CrcB expression increases alongside these genes, it would suggest potential involvement in nitrate metabolism. Researchers should also examine CrcB expression under varying nitrate concentrations, different electron donors (formate, hydrogen), and in the presence of intermediate compounds like hydroxylamine to further elucidate its regulatory patterns and potential role in the reverse-HURM pathway.

What experimental approaches can differentiate between direct and indirect roles of CrcB in nitrogen metabolism?

To differentiate between direct and indirect roles of CrcB in nitrogen metabolism, researchers should implement a comprehensive experimental strategy:

First, create a precise genetic knockout of crcB in N. profundicola using techniques like CRISPR-Cas9 or allelic exchange, then perform detailed phenotypic characterization. Compare growth rates, nitrate consumption, and ammonium production between wild-type and ΔcrcB strains under conditions known to induce the reverse-HURM pathway . Significant changes would suggest involvement, but wouldn't distinguish direct from indirect effects.

To determine direct interactions, perform in vitro reconstitution experiments with purified components. Incorporate recombinant CrcB into liposomes along with purified components of the nitrate reduction machinery and assess if its presence directly affects enzymatic activities. Complement this with isotope labeling studies using 15N-nitrate similar to those performed in the original research , comparing nitrogen incorporation patterns between wild-type and CrcB-modified strains.

Researchers should also examine the localization of CrcB in the cell membrane relative to other components of the nitrate reduction machinery using immunogold electron microscopy or super-resolution fluorescence microscopy. Co-localization would support direct functional relationships. Metabolomic profiling of wild-type versus ΔcrcB strains can reveal broader metabolic changes and identify whether CrcB effects are specific to nitrogen metabolism or reflect more general physiological adaptations.

How can stable isotope experiments be designed to trace nitrogen flow through systems involving CrcB function?

Based on the 15N isotope experiments conducted with N. profundicola , researchers can design similar approaches to investigate potential CrcB involvement in nitrogen metabolism:

Establish parallel cultures of wild-type N. profundicola and CrcB-modified strains (overexpression, knockout, or point mutations) in media containing either 15N-labeled ammonium or 15N-labeled nitrate as the sole nitrogen source. Use conditions similar to those in the original research: hydrogen and formate as electron donors, with either sulfide as sulfur source (making nitrate the sole electron acceptor) or polysulfide (as both sulfur source and potential electron acceptor) .

After growth, harvest cells and analyze 15N incorporation into biomass using isotope ratio mass spectrometry (IRMS) as was done in the original study . Compare the level of 15N enrichment between wild-type and CrcB-modified strains. If CrcB is involved in nitrogen assimilation, significant differences in 15N incorporation should be observed.

Researchers should extend these experiments by collecting culture supernatants at regular intervals to track the conversion of labeled nitrate to ammonium and any intermediate compounds. Use 15N nuclear magnetic resonance (NMR) spectroscopy to identify nitrogen-containing metabolites and trace the flow of the 15N label. Time-course sampling can reveal rate differences in nitrogen processing between wild-type and CrcB-modified strains, providing insights into the specific step(s) where CrcB might function.

What statistical approaches should be employed when analyzing data from growth experiments comparing wild-type and CrcB-modified Nautilia profundicola strains?

When analyzing data from growth experiments comparing wild-type and CrcB-modified N. profundicola strains, researchers should implement robust statistical approaches:

For growth rate comparisons, calculate specific growth rates (μ) during exponential phase using regression analysis of log-transformed cell density data. Use two-tailed heteroscedastic t-tests to compare growth rates between strains, similar to the statistical approach used in previous N. profundicola studies . When analyzing multiple growth conditions simultaneously, employ two-way ANOVA to assess both strain effects and condition effects, as well as their interactions.

For time-course experiments measuring metabolites (such as ammonium production from nitrate), use repeated measures ANOVA or mixed-effects models to account for the non-independence of measurements over time. Calculate rate constants for specific processes (e.g., nitrate consumption, ammonium production) and compare these between strains using appropriate parametric or non-parametric tests depending on data distribution.

Researchers should perform power analysis before experiments to determine appropriate sample sizes and replication needed to detect biologically meaningful differences. For gene expression studies involving CrcB and related genes, use the comparative CT (ΔΔCT) method for relative quantification, followed by statistical comparison using t-tests with appropriate correction for multiple comparisons if analyzing many genes simultaneously .

How should researchers interpret contradictory results regarding CrcB function in different experimental systems?

When faced with contradictory results regarding CrcB function across different experimental systems, researchers should implement a systematic interpretive framework:

First, carefully evaluate the experimental contexts that produced conflicting results. Different growth conditions, genetic backgrounds, or experimental techniques may explain apparent contradictions. The extreme environment that N. profundicola naturally inhabits (deep-sea hydrothermal vents) may mean that protein function is highly sensitive to experimental conditions like temperature, pressure, and redox state .

Consider that membrane proteins like CrcB may function differently in heterologous expression systems compared to their native cellular context. The absence of specific interaction partners or improper membrane insertion could lead to misleading results. Researchers should examine whether contradictions arise from direct functional assays versus indirect physiological measurements, as these approach the question of protein function from different angles.

When working with recombinant CrcB, verify that the protein is correctly folded and inserted into membranes before concluding about function. Methods like circular dichroism spectroscopy can confirm secondary structure integrity. Contradictory results may reflect genuine multifunctionality of CrcB under different conditions, rather than experimental artifacts. Considering the complex metabolic adaptations observed in N. profundicola, including the novel reverse-HURM pathway , this protein may have context-dependent functions.

How does the CrcB homolog in Nautilia profundicola compare with similar proteins in related Epsilonproteobacteria?

The CrcB homolog in N. profundicola shows important similarities and distinctions when compared with related proteins in other Epsilonproteobacteria:

Table 1: Comparison of CrcB homologs across selected Epsilonproteobacteria

*Note: These gene identifiers are for homologous proteins in the reverse-HURM pathway and not specifically CrcB; actual CrcB homologs would need verification .

While N. profundicola inhabits extreme deep-sea hydrothermal vent environments, related Campylobacter species are typically host-associated . This ecological difference may be reflected in functional adaptations of their respective CrcB homologs. The genomic context of crcB in these organisms might provide clues about functional relationships. In N. profundicola, researchers should examine if crcB is located near genes involved in the reverse-HURM pathway (napA, haoA, cycB/napC) or other nitrogen metabolism genes .

Phylogenetic analysis of CrcB sequences across Epsilonproteobacteria could reveal evolutionary patterns that correlate with metabolic capabilities or environmental adaptations. N. profundicola represents the deepest branching lineage of Epsilonproteobacteria , so its CrcB may exhibit ancestral features compared to those in Campylobacter species.

What insights can comparative genomics provide about the potential role of CrcB in the evolution of nitrate metabolism in extremophiles?

Comparative genomics offers valuable insights into CrcB's potential role in the evolution of nitrate metabolism among extremophiles:

The presence of the reverse-HURM pathway in N. profundicola and select Campylobacter species (C. concisus, C. curvus, C. fetus) but not in other Epsilonproteobacteria suggests a specific evolutionary history . By examining the co-occurrence patterns of crcB with genes encoding components of the reverse-HURM pathway across different bacterial genomes, researchers can identify potential functional relationships and evolutionary co-adaptation.

N. profundicola's position in the deepest branching lineage of Epsilonproteobacteria makes it particularly valuable for understanding ancestral metabolic capabilities. If crcB is consistently found alongside nitrate metabolism genes in these deep-branching lineages, it would suggest an ancient association between these functions.

Researchers should perform synteny analysis to determine if the genomic arrangement of crcB relative to nitrate metabolism genes is conserved across species, which would further support functional relationships. Additionally, examining selection pressure on the crcB gene (dN/dS ratios) in extremophiles versus non-extremophiles could reveal whether this gene has undergone adaptive evolution in response to specific environmental challenges.

The unusual reverse-HURM pathway for nitrate ammonification represents an alternative to classical nitrate reduction pathways . Understanding whether crcB evolved concurrently with this pathway could provide insights into how novel metabolic capabilities emerge in response to extreme environmental conditions.