Recombinant Nectria haematococca Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Nectria haematococca Altered Inheritance of Mitochondria Protein 31, Mitochondrial (AIM31)

Recombinant Nectria haematococca Altered Inheritance of Mitochondria protein 31, Mitochondrial (AIM31) refers to a specific protein derived from the fungus Nectria haematococca, produced through recombinant DNA technology . AIM31 is involved in mitochondrial function, particularly in the inheritance and maintenance of mitochondria within cells .

Gene Information

The AIM31 protein, with the code C7YJ02, consists of 230 amino acids . The recombinant form is often expressed in E. coli with an N-terminal His tag for purification purposes .

Function and Significance

AIM31 is related to mitochondrial inheritance, a process critical for maintaining a healthy population of mitochondria in cells . Mitochondria play a vital role in energy production and cellular metabolism, and their correct distribution during cell division is essential for cellular health . Proteins like AIM31 ensure that mitochondria are properly segregated to daughter cells, and that any dysfunction in this process can lead to various cellular disorders .

Recombinant Production

The recombinant production of AIM31 involves synthesizing the gene encoding the protein and inserting it into an expression vector . This vector is then introduced into a host organism, such as E. coli, where the gene is transcribed and translated to produce the AIM31 protein . The His tag attached to the protein facilitates its purification using affinity chromatography .

Research Applications

Recombinant AIM31 can be used in various research applications, including:

  • Protein Interaction Studies: To identify other proteins that interact with AIM31 and are involved in mitochondrial inheritance .

  • Structural Studies: To determine the three-dimensional structure of the protein, which can provide insights into its function .

  • Functional Assays: To study the effects of AIM31 on mitochondrial dynamics and inheritance in vivo and in vitro .

  • Drug Discovery: To identify compounds that can modulate the activity of AIM31 and potentially treat diseases related to mitochondrial dysfunction .

Related Research

Nectria haematococca has supernumerary chromosomes, which contribute to its genetic diversity and adaptability . These chromosomes contain unique genes that may be involved in niche adaptation and horizontal gene transfer . Additionally, research has shown that N. haematococca possesses a homolog of RID (RIP defective gene), which is involved in repeat-induced point mutation (RIP) . This process contributes to the evolution of the genome by introducing mutations in repetitive sequences .

Gene Expression Differences in Mutant Huntingtin Neurons Treated with SS31

GeneFold Change (SS31-treated vs. Untreated)
Drp1Decrease
Fis1Decrease
Mfn1Increase
Mfn2Increase
Opa1Increase
CypDDecrease
ND1Increase
COX1-3Increase
ATP6Increase
PGC1αIncrease
PGC1βIncrease
Nrf1Increase
Nrf2Increase
TFAMIncrease
SynaptophysinIncrease
PSD95Increase
Synapsin 1Increase
Synapsin 2Increase
Synaptobrevin 1Increase
Synaptobrevin 2Increase
NeurograninIncrease
GAP43Increase
SynaptopodinIncrease

Note: The data shows the relative changes in mRNA expression levels of various genes in mutant Huntingtin (Htt) neurons treated with SS31 compared to untreated neurons. SS31 is a mitochondria-targeted molecule that enhances mitochondrial fusion and biogenesis while also upregulating synaptic gene expression .

Immunomodulatory Protein from Nectria haematococca

A fungal immunomodulatory protein (FIP) from Nectria haematococca (FIP-nha) has been identified through homology alignment . Recombinant FIP-nha (rFIP-nha) was successfully expressed in E. coli, with a yield of 42.7 mg/L . In vitro assays showed that rFIP-nha caused hemagglutination of human and rabbit red blood cells, stimulated mouse spleen lymphocyte proliferation, and enhanced interleukin-2 (IL-2) expression . It also demonstrated a strong antitumor effect against HL60, HepG2, and MGC823 tumor cell lines .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RCF1; AIM31; NECHADRAFT_102404; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)
Target Names
RCF1
Target Protein Sequence
MADGPPSIPGPLPSSFDSDQDFYNERPMQKVFRKIKEEPLIPLGIGLTSLAFVNAYRALR RGDSKQANRMFRARVAAQGFTVIAMLAGSMYYQKDREKSKELRQLQEQRDAEEKRLKWIR ELEARDDEEKAMKARLEQRRQLVQAQRAEEAEAAAAAAATTEEKPEATSGGAGGILSRIG LWPQGEKKEEEKKVAEELVEETAGDKSGKKKNPKSSLGDLGEIISSQKKD
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant AIM31 protein?

The most documented and effective expression system for recombinant AIM31 protein is Escherichia coli. According to available data, the full-length protein (amino acids 1-230) has been successfully expressed in E. coli with an N-terminal His tag .

For optimal expression, consider the following methodology:

  • Clone the full AIM31 gene sequence into an appropriate E. coli expression vector

  • Include an N-terminal His tag for purification purposes

  • Express in E. coli under standard induction conditions

  • Purify using immobilized metal affinity chromatography (IMAC)

The yield of other fungal immunomodulatory proteins from N. haematococca expressed in E. coli has been reported at approximately 42.7 mg/L . While specific yield data for AIM31 is not available, similar yields could be expected with optimized expression conditions.

What are the optimal storage and handling conditions for recombinant AIM31 protein?

Based on commercial product specifications, the following storage and handling protocols are recommended for recombinant AIM31 protein :

ParameterRecommendation
Storage temperature-20°C/-80°C (long-term)
Working storage4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term stabilityAdd 5-50% glycerol (final concentration)
FormatAvailable as lyophilized powder
Stability warningAvoid repeated freeze-thaw cycles

For optimal results, centrifuge the vial briefly prior to opening to bring contents to the bottom. Aliquot the reconstituted protein to minimize freeze-thaw cycles for unused portions .

What experimental design strategies optimize recombinant AIM31 expression and purification?

To optimize recombinant AIM31 expression, a multivariant statistical experimental design approach is significantly more effective than traditional one-variable-at-a-time methods . This methodology allows for:

  • Simultaneous evaluation of multiple variables:

    • Temperature, induction time, media composition, inducer concentration

    • Host strain selection, vector design, codon optimization

  • Implementation of factorial design:

    • Full or fractional factorial designs to identify significant effects

    • Creation of response surface models to identify optimal conditions

For a typical AIM31 expression optimization, consider the following factorial design:

FactorLow Level (-1)High Level (+1)
Temperature18°C37°C
IPTG concentration0.1 mM1.0 mM
Induction time4 hours18 hours
MediaLBTB

The application of this approach results in:

  • Fewer experiments required to identify optimal conditions

  • Statistical validation of significant factors

  • Identification of interaction effects between variables

  • Greater reproducibility of protein expression

  • Higher yields through systematic optimization

How does the genomic context of AIM31 in N. haematococca affect its expression and function?

The genomic organization of N. haematococca provides important context for understanding AIM31 expression:

  • Genome characteristics:

    • N. haematococca has 17 chromosomes ranging from 530 kb to 6.52 Mb

    • Total genome size of 54.43 Mb with 15,707 predicted genes

    • Among the largest genomes reported for ascomycetes

  • Supernumerary chromosomes:

    • Three chromosomes (14, 15, and 17) are supernumerary

    • These chromosomes contain more repeat sequences and unique genes

    • They have lower G+C content compared to core chromosomes

    • May be conditionally dispensable depending on environmental conditions

  • Gene expansion mechanisms:

    • N. haematococca shows evidence of two types of gene expansion:
      a) Genes specific to N. haematococca not found in other fungi
      b) Genes present as multiple copies in N. haematococca but as single copies in other fungi

    • Some expansions result from lineage-specific gene duplication

    • Others may result from horizontal gene transfer

  • Repeat-induced point mutation (RIP):

    • N. haematococca possesses RIP mechanisms that can affect duplicated genes

    • Approximately 71.6% of repetitive sequences show evidence of RIP

    • Only 3.7% of unique sequences show evidence of RIP

    • RIP can introduce C:G to T:A mutations in duplicated sequences

Whether AIM31 is located on a core or supernumerary chromosome would significantly impact its expression patterns and evolutionary history. Determining its chromosomal location would provide insights into its role in N. haematococca biology .

What molecular assays can be developed to detect and quantify AIM31 expression in various contexts?

Based on methodologies developed for other N. haematococca genes, several molecular assays can be adapted for AIM31 detection and quantification :

  • PCR-based detection:

    • Design primers specific to AIM31 sequence

    • Optimize PCR conditions for specificity and sensitivity

    • Use nested PCR for enhanced sensitivity in complex samples

  • Quantitative PCR (qPCR):

    • Develop SYBR Green or TaqMan-based qPCR assays

    • Create standard curves using purified AIM31 plasmid

    • Include appropriate reference genes for normalization

  • Expression analysis:

    • Extract RNA using optimized fungal RNA extraction protocols

    • Perform RT-qPCR to quantify AIM31 transcript levels

    • Compare expression under different conditions

  • Environmental detection:

    • Adapt soil-DNA extraction protocols for environmental samples

    • Use specific primers to detect AIM31 in complex samples

    • Apply denaturing gradient gel electrophoresis (DGGE) to assess sequence diversity

A methodology similar to that developed for pathogenicity genes in N. haematococca could be applied, involving:

  • Optimization of DNA extraction from pure cultures and environmental samples

  • PCR amplification using gene-specific primers

  • Sequence verification of amplicons

  • Development of quantitative assays to measure expression levels under various conditions

How can bioinformatic analyses be used to predict functional domains and regulatory elements of AIM31?

To analyze AIM31 at the bioinformatic level, researchers should implement a comprehensive approach :

  • Sequence analysis and domain prediction:

    • Perform sequence alignment with homologous proteins using BLAST

    • Identify conserved domains using Pfam, PROSITE, or InterPro

    • Predict secondary structure elements using PSIPRED

    • Model tertiary structure using homology modeling or ab initio prediction

  • Promoter analysis:

    • Extract the upstream promoter region (~2000 bp) of AIM31

    • Use tools like BDGP Neural Network Promoter Prediction, Promoter 2.0, and TSSW to identify core promoter elements

    • Analyze transcription factor binding sites using PROMO or AliBaba 2.1

    • Construct evolutionary trees to compare promoter conservation across species

  • Regulatory element identification:

    • Identify putative transcription factor binding sites

    • Analyze for presence of regulatory motifs like RAR-alpha, C-jun, or other factors

    • Assess for methylation sites that might affect expression

For a comprehensive promoter analysis, follow the methodology described for gga-miR-31 :

  • Obtain ~2000 bp upstream of the AIM31 gene from genome databases

  • Conduct homology analysis using MEGA7 to compare with related species

  • Predict transcription factor binding sites using AliBaba 2.1 and PROMO

  • Create recombinant vectors with different promoter lengths to test activity

  • Use dual luciferase reporter systems to verify promoter activity experimentally

What are the potential mitochondrial functions of AIM31 and how can they be experimentally validated?

As a mitochondrial protein involved in respiratory supercomplex formation, AIM31/RCF1 likely plays significant roles in mitochondrial function. These can be experimentally validated through several approaches :

  • Mitochondrial localization confirmation:

    • Express fluorescently tagged AIM31 to visualize subcellular localization

    • Perform subcellular fractionation and western blotting

    • Use immunogold electron microscopy for precise localization

  • Functional characterization:

    • Generate AIM31 knockout mutants to assess phenotypic effects

    • Measure respiratory chain activity in mutants vs. wild-type

    • Assess mitochondrial membrane potential using fluorescent dyes

    • Measure oxygen consumption rates using respirometry

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation to identify interaction partners

    • Use yeast two-hybrid or proximity labeling approaches

    • Conduct blue native PAGE to assess integration into respiratory complexes

  • Stress response analysis:

    • Evaluate response to oxidative stress (like E-cadherin's role in cancer cell stress response )

    • Test growth under various metabolic conditions

    • Assess mitochondrial morphology changes under stress conditions

E-cadherin research methodology can be adapted here as it similarly deals with stress adaptation mechanisms:

  • Test how AIM31 expression affects cellular response to reactive oxygen species

  • Investigate if AIM31, like E-cadherin, activates specific metabolic pathways

  • Determine if AIM31 knockout affects stress tolerance in N. haematococca

How can structure-function relationships in AIM31 be determined through mutagenesis?

To elucidate structure-function relationships in AIM31, a systematic mutagenesis approach can be implemented :

  • Site-directed mutagenesis strategy:

    • Identify conserved amino acids across homologous proteins

    • Create alanine scanning mutations of conserved residues

    • Generate deletion mutants targeting predicted functional domains

    • Design chimeric proteins swapping domains with related proteins

  • Expression and purification of mutants:

    • Express wild-type and mutant proteins in E. coli

    • Purify using standardized protocols for consistent comparison

    • Verify protein integrity by SDS-PAGE and western blotting

  • Functional assays:

    • Develop assays specific to predicted AIM31 functions

    • Compare activity of wild-type and mutant proteins

    • Assess oligomerization states using size exclusion chromatography

    • Evaluate protein stability through thermal shift assays

  • Structural analysis:

    • Perform circular dichroism to assess secondary structure changes

    • Attempt X-ray crystallography or cryo-EM of wild-type and key mutants

    • Use hydrogen-deuterium exchange mass spectrometry to identify conformational changes

This approach would generate a comprehensive map of critical residues and regions necessary for AIM31 function, similar to methodologies used for fungal immunomodulatory proteins .

What evolutionary insights can be gained from comparative genomic analysis of AIM31 across fungal species?

Comparative genomic analysis of AIM31 across fungal species can provide significant evolutionary insights :

  • Phylogenetic analysis:

    • Identify homologs in related fungal species

    • Construct phylogenetic trees to determine evolutionary relationships

    • Assess whether AIM31 evolved through:
      a) Vertical inheritance and lineage-specific duplication
      b) Horizontal gene transfer from distantly related species

  • Selective pressure analysis:

    • Calculate Ka/Ks ratios to determine selective pressure

    • Identify regions under positive or purifying selection

    • Compare selection patterns across different fungal lineages

  • Genomic context analysis:

    • Examine synteny around AIM31 in different species

    • Determine if AIM31 is located on core or accessory chromosomes

    • Assess if chromosomal location correlates with function or expression

  • Gene family expansion analysis:

    • Determine if AIM31 belongs to an expanded gene family in N. haematococca

    • Compare copy number variation across species

    • Analyze if AIM31 shows evidence of repeat-induced point mutation (RIP)

  • G+C content analysis:

    • Compare the G+C content of AIM31 with orthologs in other species

    • Assess if G+C content suggests horizontal gene transfer

    • N. haematococca orthologs typically show 55.2% G+C content versus 53.3% for unique genes

This comprehensive analysis would place AIM31 in an evolutionary context and potentially reveal how it contributed to the adaptive capabilities of N. haematococca.

How can experimental design be optimized for studying AIM31 protein interactions?

When investigating AIM31 protein interactions, implementing a statistically robust experimental design approach is crucial :

  • Multivariant experimental design:

    • Define clear response variables (binding affinity, complex formation)

    • Identify key variables that may influence interactions (pH, temperature, ionic strength)

    • Use factorial design to test combinations of variables systematically

    • Apply response surface methodology (RSM) to optimize interaction conditions

  • Statistical power considerations:

    • Calculate appropriate sample sizes using power analysis

    • Use blocking designs to control for batch effects

    • Implement randomization to minimize bias

    • Include appropriate technical and biological replicates

  • Interaction screening strategy:

    • Begin with broad screening using yeast two-hybrid or pull-down assays

    • Validate initial hits with secondary methods (co-immunoprecipitation, FRET)

    • Quantify interaction strength using biophysical methods (ITC, SPR)

    • Characterize the structural basis using crosslinking mass spectrometry

  • Design improvement techniques:

    • Use fractional factorial designs to reduce experimental load

    • Implement design augmentation if initial results suggest missing variables

    • Apply fold-over designs to resolve confounded effects

This methodical approach significantly improves data quality and interpretation compared to traditional one-variable-at-a-time methods.

What challenges exist in heterologous expression of AIM31 and how can they be overcome?

Several challenges can arise during heterologous expression of AIM31, and specific strategies can address each issue :

  • Protein solubility challenges:

    • Challenge: Formation of inclusion bodies in E. coli

    • Solutions:

      • Lower expression temperature (18-25°C)

      • Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)

      • Co-express with molecular chaperones (GroEL/ES, DnaK)

      • Optimize induction parameters using factorial design approach

  • Codon usage bias:

    • Challenge: Suboptimal codon usage in heterologous host

    • Solutions:

      • Synthesize codon-optimized gene for expression host

      • Use specialized E. coli strains with rare tRNAs

      • Analyze codon adaptation index (CAI) to identify problematic regions

  • Post-translational modifications:

    • Challenge: Eukaryotic modifications missing in prokaryotic hosts

    • Solutions:

      • Express in yeast or insect cell systems for eukaryotic modifications

      • Use cell-free expression systems

      • Develop in vitro modification systems if specific modifications are critical

  • Protein toxicity:

    • Challenge: Toxicity to host cells

    • Solutions:

      • Use tightly regulated inducible promoters

      • Test expression in specialized "toxicity-tolerant" strains

      • Employ cell-free expression systems

A systematic optimization approach using statistical experimental design methodology will help identify the optimal combination of conditions for maximal expression of soluble, functional AIM31 protein .

How can AIM31 protein be used as a tool in mitochondrial research?

AIM31/RCF1 has significant potential as a research tool for investigating mitochondrial function :

  • As a mitochondrial marker:

    • Develop fluorescently-tagged AIM31 constructs for live imaging

    • Create antibodies against AIM31 for immunolocalization studies

    • Use AIM31 promoter-reporter fusions to monitor mitochondrial gene expression

  • For studying respiratory supercomplex assembly:

    • Use tagged versions to pull down associated respiratory complex components

    • Develop AIM31 mutants as tools to disrupt specific aspects of supercomplex formation

    • Monitor AIM31 dynamics during mitochondrial stress or cellular differentiation

  • As a genetic tool:

    • Create conditional AIM31 knockouts for temporal control of mitochondrial function

    • Use AIM31 promoter elements to drive expression of other genes in mitochondria

    • Develop AIM31-based biosensors for mitochondrial conditions

  • For comparative mitochondrial studies:

    • Utilize AIM31 homologs from different species to study mitochondrial evolution

    • Investigate species-specific differences in respiratory complex organization

    • Study how variations in AIM31 sequence relate to mitochondrial function in different organisms

  • In stress response studies:

    • Similar to E-cadherin research methodology, investigate AIM31's role in oxidative stress response

    • Examine how AIM31 influences metabolic adaptation under stress

    • Assess AIM31's contribution to mitochondrial inheritance during cellular stress

What insights from N. haematococca AIM31 can be applied to homologous proteins in other organisms?

Findings from N. haematococca AIM31 research can provide valuable insights for studying homologous proteins in other organisms :

  • Evolutionary conservation analysis:

    • Identify conserved domains and motifs across species

    • Determine which functional aspects are universal versus species-specific

    • Map how gene duplication events have led to functional diversification

  • Functional prediction:

    • Transfer functional annotations from N. haematococca AIM31 to uncharacterized homologs

    • Predict cellular localization and interaction partners of homologs

    • Identify critical residues likely to be important across all homologs

  • Comparative expression analysis:

    • Compare expression patterns of AIM31 homologs across species

    • Identify conserved regulatory elements in promoter regions

    • Determine if expression is influenced by similar environmental factors

  • Structural insights:

    • Apply structural information from N. haematococca AIM31 to model homologs

    • Predict how sequence variations might alter structure and function

    • Design experiments to test functional conservation across species

  • Methodology transfer:

    • Adapt successful purification and characterization methods for homologs

    • Transfer experimental design approaches for optimization studies

    • Implement similar mutagenesis strategies to analyze homologs

By applying comparative genomics approaches, insights from AIM31 can inform broader understanding of mitochondrial proteins across the fungal kingdom and potentially in other eukaryotes .

How can contradictory findings in AIM31 research be reconciled through experimental design?

When faced with contradictory findings in AIM31 research, a systematic approach to experimental design can help resolve discrepancies :

  • Root cause analysis:

    • Identify potential sources of variation:

      • Different expression systems or host strains

      • Variations in protein constructs (full-length vs. truncated)

      • Differences in purification methods

      • Variations in assay conditions or readouts

  • Standardization strategy:

    • Develop standardized protocols:

      • Use identical protein constructs

      • Standardize expression and purification methods

      • Establish consistent assay conditions

      • Create reference standards for quantitative measurements

  • Multi-laboratory validation:

    • Implement ring trials with identical materials and protocols

    • Document all experimental parameters meticulously

    • Use statistical methods to identify systematic biases

    • Establish minimal reporting standards for AIM31 research

  • Complementary methodologies:

    • Apply orthogonal techniques to examine the same question

    • Combine in vitro and in vivo approaches

    • Use both structural and functional assays

    • Integrate computational and experimental methods

  • Advanced experimental design:

    • Implement factorial designs to identify interaction effects

    • Use blocking to control for nuisance variables

    • Apply response surface methodology to map optimal conditions

    • Document experiments according to reporting guidelines like ARRIVE

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.