Recombinant Nectria haematococca Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MIC60; NECHADRAFT_75325; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-633
Protein Length
Full Length of Mature Protein
Species
Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)
Target Names
MIC60
Target Protein Sequence
AVDKKPESASSPSLPNTQSVASDKIHETTIDDVGETKAATVDAPKTTPPPPPPPPAPKKK GFFRRLRNFVFTLFVLGAVGFAGGVWYSCFSDNFHDFFTGYVPFGEQAVLYLEEMEYKKR FPNSATNAKSRDADGAVRIPAQSGASWRVADGTRRSSAGPVPAKQEEPKAEAPKPKAAEP KPTAKVVEKPAPTPAPAPTPRSESGFKAPEVNEPSRYPPLKPIDLLSLDDAREPVIQDLV HMVNDLILVINADGAHGRYGSSVNKAKNEITKVGGKLKGMKEQFEKKAAGQVRDKIDEFD KAATDLIDRVESAMITQESQWRHEFEEEMKKVRENYEDRVKVLLERERKLNEEKLQNQLL EQALALKKEFVKDVENQVEQERESRLGKLTALSSAVADLEKLTTGWNEVLDTNLQTQQLH VAVEAVRASLEDDHHPRPFIRELVALREIASDDPVVNAAIASVNPTAYQRGISTSSQLID RFRRVANEVRKASLLPDEAGVASHASSWVLSHVMFKKQGLAEGNDVESVLTRTQTYLEEG DLDSAAREMNGLEGWAKTLSKDWLGEVRKVLEVQQALDVIATEARLQSLRVD
Uniprot No.

Target Background

Function
Recombinant *Nectria haematococca* Formation of Crista Junctions protein 1 (FCJ1) is a component of the Mitochondrial Cristae Organization (MICOS) complex, a large protein complex within the mitochondrial inner membrane. The MICOS complex plays critical roles in maintaining crista junctions, inner membrane architecture, and forming contact sites with the outer membrane. FCJ1 helps maintain connections between cristae membranes and the inner boundary membrane, and facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the Nectria haematococca FCJ1 protein and what is its function?

The FCJ1 protein from Nectria haematococca is a mitochondrial membrane protein specifically enriched in crista junctions (CJs). It functions as a key component in the formation and maintenance of crista junctions, which are important architectural features for mitochondrial organization and function . FCJ1 is the fungal homolog of the mammalian mitofilin protein and is also known as MICOS complex subunit MIC60 . The protein forms part of the larger MICOS (mitochondrial contact site and cristae organizing system) complex that is essential for proper cristae morphology .

Functionally, FCJ1 acts antagonistically to F1FO-ATP synthase subunits e and g to locally modulate the oligomeric state of F1FO, thereby controlling membrane curvature to generate crista junctions and cristae tips . Studies have shown that cells lacking FCJ1 exhibit defects in crista junction formation, often resulting in concentric stacks of inner membrane within the mitochondrial matrix .

How should recombinant FCJ1 protein be reconstituted and stored for experimental use?

For optimal experimental use, follow these methodological guidelines:

  • Initial preparation: Briefly centrifuge the vial prior to opening to bring contents to the bottom.

  • Reconstitution protocol:

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

    • For long-term storage, add glycerol to a final concentration of 5-50% (recommended: 50%).

    • Aliquot to avoid multiple freeze-thaw cycles.

  • Storage conditions:

    • Long-term storage: -20°C or -80°C (preferred for extended periods).

    • Working aliquots: Store at 4°C for up to one week.

    • Avoid repeated freeze-thaw cycles as they may compromise protein integrity .

  • Quality control: Before experimental use, verify protein integrity by SDS-PAGE and/or Western blot to confirm expected molecular weight and lack of degradation.

What methodological approaches are recommended for studying FCJ1's role in crista junction formation?

Several complementary methodological approaches are recommended for investigating FCJ1's role in crista junction formation:

  • Genetic manipulation:

    • CRISPR/Cas9 genome editing to create knockout cell lines lacking FCJ1 .

    • Inducible expression systems to control FCJ1 levels and study dynamic changes in crista morphology.

    • Site-directed mutagenesis to identify functional domains and residues crucial for protein-protein interactions.

  • Microscopy techniques:

    • Super-resolution light microscopy to visualize FCJ1 distribution and dynamics.

    • 3D electron microscopy (EM) for detailed visualization of crista junction architecture .

    • Immuno-EM with gold-labeled antibodies to precisely localize FCJ1 within the mitochondrial membrane.

  • Biochemical characterization:

    • Blue native PAGE (BN-PAGE) to analyze the oligomeric state of FCJ1 and its interactions with other proteins.

    • Co-immunoprecipitation assays to identify interaction partners.

    • Crosslinking studies to capture transient protein-protein interactions.

  • Functional assays:

    • Mitochondrial respiration measurements to assess the functional consequences of FCJ1 manipulation.

    • Membrane potential analysis to examine the relationship between crista structure and bioenergetics.

    • Protein import assays to study the effect of altered crista morphology on mitochondrial protein transport .

How does FCJ1 interact with other components of the MICOS complex to regulate crista junction architecture?

FCJ1 (MIC60) interacts with multiple proteins to form the MICOS complex and regulate crista junction architecture:

  • Interaction with Mic19 (CHCHD3):

    • Mic19 promotes the tetramerization of Mic60/FCJ1 through a conserved interface between the Mic60 mitofilin domain and Mic19 CHCH domain .

    • This tetrameric assembly forms an elongated, bow tie-shaped structure that is crucial for stabilizing crista junctions .

    • Biochemical analysis shows that purified Mic19 induces the formation of a heteromeric species containing four molecules each of Mic60 and Mic19 .

  • Formation of two distinct subcomplexes:

    • The Mic60-subcomplex (including FCJ1) is sufficient for crista junction formation.

    • The Mic10-subcomplex controls lamellar cristae biogenesis.

    • Complete assembly of the MICOS complex triggers remodeling of pre-existing unstructured cristae and de novo formation of crista junctions on existing cristae .

  • Interaction with F1FO-ATP synthase:

    • FCJ1 works antagonistically with F1FO-ATP synthase subunits e and g.

    • While F1FO subunits e/g promote oligomerization of F1FO and are essential for cristae tip formation, FCJ1 appears to locally prevent this oligomerization at sites where crista junctions form .

    • This antagonistic relationship creates a balance that determines membrane curvature at different regions of the cristae .

  • Structural basis of membrane interaction:

    • Dimerization of mitofilin domains exposes a crescent-shaped membrane-binding site with convex curvature specifically designed to interact with curved crista junction necks.

    • The Mic60-Mic19 subcomplex traverses crista junctions as a molecular strut, thereby controlling junction architecture and function .

What is the relationship between FCJ1/MIC60 and OPA1 in maintaining mitochondrial membrane architecture?

The relationship between FCJ1/MIC60 and OPA1 in maintaining mitochondrial membrane architecture involves several key aspects:

  • Complementary but distinct functions:

    • OPA1 (dynamin-like GTPase) influences cristae architecture but has a more moderate effect compared to the dramatic phenotypes seen in MICOS subunit knockouts .

    • OPA1 depletion in wild-type cells reduces cristae lamellae by approximately 10%, resulting in shorter, disordered, or partly swollen cristae .

  • Stabilization of tubular crista junctions:

    • OPA1 plays a crucial role in stabilizing tubular crista junctions, particularly in the absence of Mic10.

    • In Mic10-knockout cells, depletion of OPA1 further reduces the number of crista junctions by 66% in non-septate mitochondria, suggesting OPA1 works with the Mic10-subcomplex to stabilize tubular crista junctions .

  • Influence on MICOS distribution:

    • OPA1 and Mic10 antagonistically determine the distribution and size of Mic60/FCJ1 assemblies.

    • Simultaneous depletion of both OPA1 and Mic10 leads to scattered Mic60 clusters, affecting the proper organization of crista junctions .

  • Functional interactions in cristae remodeling:

    • OPA1 is involved in inner membrane fusion and potentially also in fission processes.

    • During apoptosis, remodeling of crista junctions has been reported to depend on OPA1 .

    • OPA1, along with F1FO-ATP synthase, fine-tunes the positioning of the MICOS complex and crista junctions .

  • Genetic and physical interactions:

    • Genetic and physical interactions between F1FO-ATP synthase, OPA1, and MICOS have been demonstrated, suggesting a coordinated regulatory network controlling cristae development .

What experimental protocols are most effective for studying protein-protein interactions involving recombinant FCJ1?

To effectively study protein-protein interactions involving recombinant FCJ1, researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express FCJ1 with different tags (His, Flag, etc.) to facilitate pull-down experiments.

    • Use mild detergents (e.g., digitonin) to preserve native protein interactions.

    • Validate interactions using reciprocal Co-IPs with suspected binding partners.

    • Example protocol: Express His-tagged FCJ1 in E. coli, purify using Ni-NTA affinity chromatography, then incubate with mitochondrial lysates followed by pull-down and Western blot analysis for interacting partners .

  • Blue Native PAGE (BN-PAGE):

    • Useful for analyzing the formation of native protein complexes.

    • Can reveal higher-order assemblies and their stoichiometry.

    • Valuable for studying the effects of protein modifications or mutations on complex formation.

    • Example application: BN-PAGE revealed that addition of purified C. thermophilum Mic19 induced the formation of a heteromeric species containing four molecules each of Mic60 and Mic19 .

  • Structure-based crosslinking:

    • Design crosslinks based on structural information to stabilize specific protein-protein interfaces.

    • Example: Introducing a structure-based disulfide bridge (R525C) in C. thermophilum Mic60 stabilized a tetrameric assembly even in the absence of Mic19, confirming the tetrameric interface involved in the Mic60-Mic19 complex .

  • Mutational analysis:

    • Create targeted mutations in potential interaction interfaces.

    • Example: A double amino acid substitution (V455D/F461D) in the tetrameric interface greatly reduced higher-order assembly of Mic60 both in the absence and presence of Mic19 .

  • Reconstitution assays:

    • Combine purified recombinant proteins to reconstitute complexes in vitro.

    • Analyze complex formation using techniques like size exclusion chromatography, analytical ultracentrifugation, or light scattering.

    • This approach allows precise control over protein concentrations and conditions to study assembly dynamics.

How do variations in expression systems affect the structural and functional properties of recombinant FCJ1 protein?

Different expression systems can significantly impact the structural and functional properties of recombinant FCJ1 protein:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coli- High yield
- Cost-effective
- Simple culture conditions
- Limited post-translational modifications
- Potential issues with membrane protein folding
- Basic structural studies
- Antibody production
- Domain analysis
Yeast- Eukaryotic post-translational modifications
- Native-like folding environment
- Good for membrane proteins
- Lower yield than E. coli
- More complex culture conditions
- Functional studies
- Protein-protein interaction analyses
- Structural studies
Baculovirus- Advanced eukaryotic post-translational modifications
- High expression levels
- Good for complex proteins
- Time-consuming process
- Higher cost
- Technical expertise required
- Structural biology applications
- Functional assays
- Crystallization
Mammalian cells- Most authentic post-translational modifications
- Native-like protein folding
- Best for complex multi-domain proteins
- Lowest yield
- Highest cost
- Most demanding culture conditions
- High-fidelity functional studies
- Analysis of regulatory modifications
- Complex interaction networks

Key methodological considerations:

  • Post-translational modifications:

    • FCJ1 may require specific post-translational modifications for proper function or interactions.

    • Mammalian or yeast systems are preferable when studying interactions with mammalian proteins.

  • Protein solubility and folding:

    • As a membrane protein, FCJ1 presents folding challenges in heterologous systems.

    • Using fusion tags (SUMO, MBP, etc.) can improve solubility, particularly in E. coli.

    • Co-expression with chaperones may enhance proper folding.

  • Purification strategy adaptation:

    • Expression system selection affects downstream purification approaches.

    • E. coli-expressed FCJ1 typically requires more rigorous denaturation/refolding protocols.

    • Yeast and mammalian expressions often yield properly folded protein but may require gentle detergent extraction .

  • Functional validation:

    • Regardless of expression system, functional assays should verify that recombinant FCJ1 retains native-like properties.

    • Activity assays may include membrane binding studies or reconstitution into liposomes to assess membrane-shaping abilities.

What are the most effective strategies for optimizing recombinant FCJ1 protein expression and purification?

For optimal expression and purification of recombinant FCJ1 protein, consider these methodological strategies:

  • Construct design optimization:

    • Express mature protein (residues 42-633) rather than the full-length sequence including the signal peptide.

    • Consider domain-specific constructs when full-length protein presents expression challenges.

    • Include appropriate tags (His, GST, MBP) based on downstream applications and solubility requirements.

    • For challenging constructs, follow the approach used for C. thermophilum Mic60, excluding the transmembrane region (residues 208-691) to improve solubility .

  • Expression system selection based on experimental goals:

    • For structural studies: E. coli expression with codon optimization and fusion partners to improve solubility.

    • For functional studies: Yeast or insect cell systems to maintain native-like properties.

    • For interaction studies with mammalian proteins: Mammalian expression systems for authentic post-translational modifications.

  • Expression condition optimization:

    • For E. coli: Test multiple strains (BL21(DE3), Rosetta, C41/C43 for membrane proteins).

    • Optimize induction parameters (temperature, IPTG concentration, induction time).

    • Consider auto-induction media for gentler expression of challenging proteins.

    • For difficult constructs, low temperature expression (16-18°C) often improves folding.

  • Purification protocol refinement:

    • Two-step purification: Initial affinity chromatography followed by size exclusion chromatography.

    • For membrane-associated regions, include appropriate detergents (digitonin, DDM, LMNG).

    • Consider on-column refolding for proteins expressed in inclusion bodies.

    • Optimize buffer conditions (pH, salt concentration, additives like glycerol or trehalose) to enhance stability .

  • Quality control measures:

    • Analytical size exclusion chromatography to assess oligomeric state.

    • Circular dichroism to verify secondary structure content.

    • Thermal shift assays to optimize buffer conditions for stability.

    • For functional studies, verify membrane binding activity using liposome flotation assays.

How can researchers effectively design experiments to study the dynamics of FCJ1's role in cristae remodeling?

To effectively study the dynamics of FCJ1's role in cristae remodeling, researchers should design experiments that capture both spatial and temporal aspects of the process:

  • Inducible expression systems for time-course studies:

    • Develop cell lines with inducible FCJ1 expression (e.g., Tet-On/Off systems).

    • This approach allows temporal control to study the sequence of events during cristae formation.

    • Example: Re-expression of MICOS proteins in knockout cell lines has shown that the holo-MICOS complex causes extensive remodeling of pre-existing aberrant cristae, including formation of secondary crista junctions .

  • Live-cell imaging approaches:

    • Use fluorescently tagged FCJ1 variants (ensuring tags don't interfere with function).

    • Employ super-resolution microscopy techniques (STED, PALM, STORM) to overcome the diffraction limit.

    • Combine with fluorescent markers for other mitochondrial structures to study co-localization dynamics.

    • Time-lapse imaging to capture the process of cristae remodeling in real-time.

  • Correlative light and electron microscopy (CLEM):

    • Bridges the gap between fluorescence microscopy and EM.

    • Allows tracking of specific proteins (via fluorescence) while obtaining ultrastructural details (via EM).

    • Particularly valuable for connecting FCJ1 localization with specific cristae morphologies.

  • Genetic interaction studies:

    • Systematic depletion of FCJ1 in combination with other MICOS components or factors involved in cristae maintenance.

    • Example: Studies have shown that simultaneous depletion of OPA1 and Mic10 further reduces the number of crista junctions, suggesting OPA1 works with the Mic10-subcomplex to stabilize tubular crista junctions .

  • Reconstitution of cristae-like structures in vitro:

    • Purify recombinant FCJ1/MICOS components and reconstitute with liposomes.

    • Monitor membrane deformation using negative-stain EM or cryo-EM.

    • Test the effects of different lipid compositions on FCJ1's membrane-shaping abilities.

  • Triggering mitochondrial stress responses:

    • Apply stimuli known to trigger cristae remodeling (e.g., apoptotic signals, respiratory chain inhibitors).

    • Monitor FCJ1 dynamics during the response to identify its role in adaptation to stress.

    • Example: Studies have shown that OMA1 can cleave Mic19 at the N-terminal in response to mitochondrial stress induced by CCCP treatment .

What biophysical techniques provide the most insight into FCJ1 structure-function relationships?

Several biophysical techniques offer complementary insights into FCJ1 structure-function relationships:

How can recombinant FCJ1 be used to study mitochondrial dysfunction in disease models?

Recombinant FCJ1 can be a valuable tool for studying mitochondrial dysfunction in disease models through several methodological approaches:

  • Rescue experiments in knockout/knockdown models:

    • Generate cell lines with depleted endogenous FCJ1/MIC60.

    • Reintroduce wild-type or mutant forms of recombinant FCJ1 to assess functional rescue.

    • Quantify mitochondrial parameters (respiration, membrane potential, ROS production) to evaluate functional recovery.

    • This approach can identify critical functional domains and disease-relevant mutations .

  • Structural mimicry of disease-associated variants:

    • Produce recombinant FCJ1 proteins with mutations corresponding to disease-associated variants.

    • Compare biochemical properties (stability, interaction profile, oligomerization) with wild-type protein.

    • Assess effects on membrane binding and remodeling capabilities in reconstituted systems.

  • Competitive inhibition studies:

    • Use recombinant FCJ1 domains as dominant negative inhibitors.

    • Introduce specific domains that can disrupt endogenous MICOS complex formation.

    • Monitor effects on cristae morphology and mitochondrial function.

    • This approach can delineate domain-specific functions in the context of intact cells.

  • High-throughput screening platforms:

    • Develop assays using recombinant FCJ1 to screen for compounds that modulate its activity.

    • Identify small molecules that could potentially restore FCJ1 function in disease states.

    • Example assays: Thermal shift assays for stability, FRET-based interaction assays, membrane remodeling assays.

  • Biomarker development:

    • Use highly purified recombinant FCJ1 to develop sensitive antibodies for detection in clinical samples.

    • Establish quantitative assays to measure FCJ1/MIC60 levels or modifications in patient tissues.

    • Correlate alterations with disease progression or treatment response.

What techniques can be used to assess the functional integrity of recombinant FCJ1 protein preparations?

To assess the functional integrity of recombinant FCJ1 protein preparations, researchers should employ a combination of biochemical, biophysical, and functional assays:

  • Biochemical characterization:

    • SDS-PAGE and Western blotting to verify molecular weight and purity (>85% purity expected) .

    • Mass spectrometry to confirm protein identity and detect any post-translational modifications or truncations.

    • Size exclusion chromatography to assess oligomeric state and homogeneity.

    • Thermal shift assays to evaluate protein stability under various buffer conditions.

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content.

    • Limited proteolysis to probe for properly folded domains (properly folded domains typically show resistance to proteolytic digestion).

    • Dynamic light scattering to detect aggregation.

  • Protein-protein interaction verification:

    • Pull-down assays with known interaction partners (e.g., Mic19).

    • Surface plasmon resonance (SPR) to quantify binding kinetics.

    • Blue native PAGE to assess complex formation capabilities.

    • Verification that FCJ1 can induce the expected oligomeric transitions (e.g., tetramerization in the presence of Mic19) .

  • Membrane binding and remodeling assays:

    • Liposome co-sedimentation or flotation assays to verify membrane binding capability.

    • Negative-stain electron microscopy of protein-liposome mixtures to visualize membrane remodeling.

    • GUV-based assays to directly observe membrane deformation activities.

  • Functional reconstitution:

    • In vitro reconstitution of partial MICOS complexes.

    • Crista junction-like structure formation in artificial membrane systems.

    • Assessment of the ability to generate negative membrane curvature characteristic of CJs.

  • Cellular functional rescue:

    • Complementation assays in FCJ1-knockout cells.

    • Restoration of normal cristae morphology as visualized by electron microscopy.

    • Recovery of mitochondrial functional parameters (respiration, membrane potential).

What are the current limitations in studying FCJ1 function and how might they be overcome?

Current limitations in studying FCJ1 function and potential solutions include:

  • Challenges in expression and purification of full-length protein:

    • Challenge: Longer constructs of FCJ1/Mic60 are difficult to express in soluble form .

    • Solution: Use alternative expression systems, fusion tags to improve solubility, or express individual domains separately for specific studies.

    • Example approach: When longer constructs of FCJ1 couldn't be expressed in soluble form, researchers successfully used Mic60 from Chaetomium thermophilum for biochemical analysis .

  • Difficulties in high-resolution structural determination:

    • Challenge: FCJ1/Mic60 contains multiple domains and flexible regions, complicating crystallization.

    • Solution: Employ hybrid approaches combining X-ray crystallography of individual domains with cryo-EM for larger assemblies, or use integrative structural biology combining multiple low-resolution techniques.

    • Recent advances: Structural studies have revealed that the central coiled-coil domain of Mic60 forms an elongated, bow tie-shaped tetrameric assembly .

  • Complexity of multiprotein MICOS complex:

    • Challenge: Studying FCJ1 in isolation misses important context of its native complex.

    • Solution: Develop co-expression systems for multiple MICOS components, use cell-free expression systems, or employ genetic approaches to study component interactions in vivo.

    • Progress: Studies have shown that the Mic60-subcomplex is sufficient for CJ formation, while the Mic10-subcomplex controls lamellar cristae biogenesis .

  • Technical limitations in visualizing dynamic processes:

    • Challenge: Difficulty in capturing dynamic cristae remodeling events in real-time.

    • Solution: Develop improved live-cell super-resolution imaging techniques, use correlative light and electron microscopy (CLEM), or employ rapid fixation techniques to capture transient states.

    • Recent application: Researchers have used super-resolution light and 3D electron microscopy to dissect the roles of MICOS proteins in the formation of cristae in human mitochondria .

  • Reproducibility challenges in membrane protein biochemistry:

    • Challenge: Membrane protein purification and reconstitution often suffer from batch-to-batch variability.

    • Solution: Standardize protocols, develop quality control metrics, and use internal controls for functional assays.

How might advances in structural biology and imaging techniques further our understanding of FCJ1 in cristae architecture?

Advances in structural biology and imaging techniques will significantly enhance our understanding of FCJ1's role in cristae architecture:

  • Cryo-electron tomography (cryo-ET) advancements:

    • In situ visualization of FCJ1/MICOS in its native mitochondrial environment at molecular resolution.

    • Direct observation of how FCJ1 organizes at crista junction sites and interacts with other mitochondrial components.

    • Potential for visualizing different functional states of crista junctions under various physiological conditions.

  • Integrative structural biology approaches:

    • Combining multiple techniques (X-ray crystallography, NMR, cryo-EM, SAXS, XL-MS) to generate comprehensive structural models.

    • Building complete molecular models of the MICOS complex and its interactions with other mitochondrial components.

    • Example direction: Extending current insights from the tetrameric assembly of the Mic60 central coiled-coil domain to understand the entire complex architecture .

  • Single-particle cryo-EM improvements:

    • Advances in detectors and processing algorithms enabling higher resolution structures of membrane protein complexes.

    • Potential for visualizing conformational heterogeneity in the MICOS complex.

    • Capturing different functional states to understand the molecular mechanisms of membrane remodeling.

  • Super-resolution microscopy innovations:

    • Improved spatial resolution approaching the nanometer scale.

    • Multicolor imaging to simultaneously track multiple MICOS components.

    • Techniques like MINFLUX or expansion microscopy to visualize sub-mitochondrial protein distributions with unprecedented detail.

  • Correlative microscopy approaches:

    • Combining functional readouts with structural visualization.

    • Linking specific biochemical states to ultrastructural features.

    • Example application: Tracking the consequences of FCJ1 mutations on both protein localization and cristae morphology simultaneously.

  • In vitro reconstitution advancements:

    • Reconstituting minimal systems for crista junction formation with purified components.

    • Direct visualization of membrane remodeling activities of FCJ1 and MICOS components.

    • Testing mechanistic hypotheses about how FCJ1 generates negative membrane curvature at crista junctions.

These technological advances will help resolve current debates about the precise mechanism by which FCJ1/Mic60 induces membrane curvature, how it coordinates with other MICOS components, and how these interactions are regulated in response to mitochondrial stress and metabolic demands.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.