Recombinant Nectria haematococca Putative dipeptidase NECHADRAFT_87110 (NECHADRAFT_87110)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Nectria haematococca Putative dipeptidase NECHADRAFT_87110 (NECHADRAFT_87110) is a protein that belongs to the dipeptidase family, derived from the fungus Nectria haematococca . Nectria haematococca, also known as Fusarium solani, is a fungus with diverse biological properties, acting as both a saprophyte in various environments and a pathogen to plants and, in rare cases, humans . The protein NECHADRAFT_87110 is classified as a putative dipeptidase, suggesting it is predicted to function as a dipeptidase based on sequence homology and structural characteristics .

Gene and Genome Context

Nectria haematococca has a large fungal genome, containing 15,707 genes, which may relate to its diverse habitats . Within this genome, NECHADRAFT_87110 is identified by the gene symbol NECHADRAFT_87110 . A study using reciprocal BLASTp searches between F. graminearum and N. haematococca MPVI proteomes identified 8,922 possible orthologs, representing 56.8% of the genes in N. haematococca MPVI . The remaining 6,785 genes in N. haematococca MPVI were identified as ‘unique’ genes, where pseudoparalogs are found .

Protein Production and Characteristics

Recombinant NECHADRAFT_87110 protein can be produced in E. coli with a His-tag for purification and detection . The full-length protein consists of 482 amino acids .

Function and Pathways

NECHADRAFT_87110 is involved in several biochemical functions and pathways .

Interactions

NECHADRAFT_87110 interacts directly with other proteins and molecules, as detected through methods like yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NECHADRAFT_87110; Putative dipeptidase NECHADRAFT_87110
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)
Target Names
NECHADRAFT_87110
Target Protein Sequence
MADTQTPNLQNTAEGDANTSAENERSLTVRANHQSQNTRSWLRYPFLVAGIALFLGPFSF FWPREGPIDSKDYVERTKRVLKTTPLIDGHNDLPWQLRIELHNRIYDGRVDLSKKLLGHT DIQRMRQGMVGGQFWSVYVDCDTQQQHFEDPSWVVRDTLEQIDVTRRFVNEHPEHLQYCD TPACAREAFKSGRISSMIGIEGGHQVGGSIGAIRQMFNLGARYITLTHNCDNAFGTSAST VAAGGADQGLFKLGYDAVKEMNRLGMMVDLSHVSHQTMRDVLGVTRAPVIFSHSGAYAVE PHLRHAPDDVLRLVKQNGGIVMAVFVNRFLNMKNPDQATIHDVVDHILHIAEVCGWECVG IGSDFSGTPFVPVGLEDVSKFPDLIQLLMERGATDQQIRLLAGENILRVWGKIEQRAKEL QAGGEKPIEAEYEGRNWHKGMKNSPWMLRRSRDEALVNGAADQPFMFNVDSEGKHNPVVK QV
Uniprot No.

Target Background

Function

This recombinant Nectria haematococca Putative dipeptidase NECHADRAFT_87110 (NECHADRAFT_87110) hydrolyzes a wide range of dipeptides.

Database Links
Protein Families
Metallo-dependent hydrolases superfamily, Peptidase M19 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Nectria haematococca Putative dipeptidase NECHADRAFT_87110?

Recombinant Nectria haematococca Putative dipeptidase NECHADRAFT_87110 is a full-length protein (482 amino acids) classified as a putative dipeptidase enzyme. This protein originates from Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI), also known as Fusarium solani subsp. pisi. The recombinant version is typically expressed in E. coli expression systems with a terminal tag (commonly His-tag) to facilitate purification and analysis . The protein's UniProt ID is C7ZIE1, and it functions as a peptide-cleaving enzyme with specificity for certain dipeptide bonds .

What is the functional classification of NECHADRAFT_87110 in enzymatic terms?

NECHADRAFT_87110 is classified as a putative dipeptidase (EC 3.4.13.19), which belongs to the broader class of hydrolase enzymes . Dipeptidases specifically cleave dipeptide bonds, releasing individual amino acids. Based on comparison with well-characterized dipeptidases like human dipeptidyl peptidase II (DPPII), NECHADRAFT_87110 likely functions by hydrolyzing peptide bonds between two amino acids, though its specific substrate preference and catalytic properties would require experimental verification .

Unlike aminopeptidases that cleave amino acids from the N-terminal end of peptides, dipeptidases like NECHADRAFT_87110 specifically target dipeptide bonds, breaking them down into free amino acids10. This enzymatic activity places it in a crucial role in peptide metabolism pathways.

What are the optimal expression and purification strategies for NECHADRAFT_87110?

Based on published methodologies for similar recombinant proteins, the following optimized protocol is recommended:

Expression System:

  • E. coli strain BL21(DE3) is typically used for optimal expression

  • Expression vector containing NECHADRAFT_87110 with an N-terminal His-tag

  • Culture conditions: LB medium with appropriate antibiotics, induced with 0.5-1 mM IPTG at OD600 ~0.6

  • Induction temperature: 16-18°C for 18-20 hours to enhance proper folding

Purification Strategy:

  • Cell lysis in Tris-based buffer (pH 8.0) containing protease inhibitors

  • Ni-NTA affinity chromatography (binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole; elution buffer: same with 250-300 mM imidazole)

  • Size exclusion chromatography for further purification

  • Store purified protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Quality Control Checks:

  • SDS-PAGE analysis (>90% purity required)

  • Western blot confirmation

  • Activity assay using appropriate dipeptide substrates

How should enzymatic activity assays be designed for NECHADRAFT_87110?

Enzymatic activity of NECHADRAFT_87110 can be assessed using methodologies adapted from dipeptidase characterization studies:

Spectrophotometric Assay:

  • Use chromogenic substrates like dipeptide-pNA (p-nitroanilide) derivatives

  • Standard reaction mixture: 15-20 ng purified enzyme with substrate concentrations ranging from 0.01-11 mM

  • Buffer conditions: 0.05 M cacodylic acid/NaOH buffer (pH 5.5) or alternatives for pH profiling

  • Monitor p-nitroaniline release at 405 nm for 10 minutes at 37°C

  • Calculate activity using: Units = μmol p-nitroaniline released per minute

Fluorogenic Assay Alternative:

  • Use fluorogenic substrates like dipeptide-4Me2NA (4-methoxy-2-naphthylamide)

  • Monitor release of 4-methoxy-2-naphthylamine (excitation: 340 nm, emission: 430 nm)

  • Same buffer conditions as spectrophotometric assay

Substrate Preference Determination:
Test various dipeptide-derived substrates to determine specificity profile (examples include Ala-Pro-pNA, Lys-Ala-pNA). Record and compare kinetic parameters (kcat, Km) for each substrate.

What factors affect the stability and storage of recombinant NECHADRAFT_87110?

The following factors significantly impact NECHADRAFT_87110 stability and should be carefully controlled:

Storage Conditions:

  • Optimal storage: -20°C/-80°C for long-term storage

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Stabilizing Factors:

  • Addition of glycerol (30-50% final concentration) improves stability during storage

  • Trehalose (6%) helps maintain protein structure during lyophilization and storage

  • pH stability: maintain near pH 8.0 for maximum stability

Destabilizing Factors to Avoid:

  • Repeated freeze-thaw cycles (limit to <3 cycles)

  • Extreme pH conditions (<pH 4.0 or >pH 9.0)

  • Metal chelators (if metal-dependent active site is present)

  • Prolonged exposure to room temperature

How does pH affect the activity and kinetic parameters of NECHADRAFT_87110?

While specific pH profile data for NECHADRAFT_87110 is not directly provided in the search results, we can draw insights from related dipeptidases:

Expected pH Profile:

  • Optimal activity likely occurs in mildly acidic conditions (pH 5.0-6.0), similar to other characterized dipeptidases like DPPII

  • pH dependence is best analyzed using a double-ionization equation that produces a bell-shaped curve :

v=vlim(1+[H+]K1+K2[H+])v = \frac{v_{lim}}{(1 + \frac{[H^+]}{K_1} + \frac{K_2}{[H^+]})}

Where v_lim represents the maximum velocity of the active enzyme form, and K₁ and K₂ are the acid dissociation constants of enzymic groups whose ionization state controls velocity .

Methodology for pH Profiling:

  • Test activity across pH range 3.0-8.5 (in 0.25 increments)

  • Use a buffer system containing multiple components (e.g., 0.025 M ethanoic acid, 0.025 M cacodylic acid, 0.025 M HEPES, 0.1 M NaCl)

  • Measure activity at two substrate concentrations: one ≤0.5 Km and another well above Km

  • Plot both kcat and kcat/Km versus pH to identify pH optimum and the ionizable groups involved in catalysis

What are the kinetic parameters of NECHADRAFT_87110 with different substrates?

Specific kinetic parameters for NECHADRAFT_87110 are not provided in the search results, but a methodological approach to determine these values would include:

Kinetic Parameter Determination:

  • Measure initial velocities at various substrate concentrations (range: 0.01-11 mM)

  • Plot data using Michaelis-Menten equation and determine:

    • Km (substrate concentration at half-maximal velocity)

    • kcat (turnover number)

    • kcat/Km (catalytic efficiency)

Expected Substrate Preference Table:

SubstrateExpected Km (μM)Expected kcat (s⁻¹)Expected kcat/Km (M⁻¹·s⁻¹)
Ala-Pro-pNA100-50010-5010⁴-10⁵
Lys-Ala-pNA200-8005-2510³-10⁴
X-Pro derivativesLower Km expectedHigher kcat expectedHigher efficiency expected

Note: The above values are estimates based on typical dipeptidase kinetics and would need experimental verification for NECHADRAFT_87110.

How do inhibitors affect NECHADRAFT_87110 activity and what can they reveal about the active site?

Inhibitor studies provide critical insights into enzyme mechanism and active site structure:

Inhibition Analysis Protocol:

  • Pre-incubate enzyme with inhibitor for 15 minutes at 37°C

  • Add substrate and measure residual activity

  • Determine IC₅₀ using substrate concentrations near the Km value with multiple inhibitor concentrations (0-160 μM)

  • For Ki determination, use multiple substrate concentrations (10-1000 μM) and multiple inhibitor concentrations (0-160 μM)

Potential Inhibitors:

  • Lysyl-piperidide (known inhibitor of DPPII with Ki ~0.9 μM at pH 5.5)

  • Metal chelators (if metal-dependent)

  • Class-specific dipeptidase inhibitors

Inhibition Mechanism Analysis:
For competitive inhibitors, data can be fitted to the equation:

v=Vmax×[S]Km×(1+[I]Ki)+[S]v = \frac{V_{max} \times [S]}{K_m \times (1 + \frac{[I]}{K_i}) + [S]}

Where [I] is inhibitor concentration and Ki is the inhibition constant .

How can structural prediction tools be applied to understand NECHADRAFT_87110 function?

Recent advances in protein structure prediction offer powerful approaches to understanding NECHADRAFT_87110:

AI-Based Structure Prediction:

  • AlphaFold2 and related tools can generate high-confidence 3D models of NECHADRAFT_87110

  • These models can reveal:

    • Potential active site residues

    • Substrate binding pocket architecture

    • Structural elements that determine specificity

Structure-Function Analysis Workflow:

  • Generate 3D structure prediction using AlphaFold2

  • Identify conserved domains through comparison with known dipeptidase structures

  • Perform computational docking of potential substrates to identify key interaction residues

  • Design site-directed mutagenesis experiments to validate computational predictions

  • Correlate structural features with experimentally determined enzymatic properties

What are approaches to resolving contradictory experimental data when characterizing NECHADRAFT_87110?

When facing contradictory results in NECHADRAFT_87110 characterization, consider these methodological approaches:

Contradiction Resolution Framework:

  • Context Analysis: Many apparent contradictions result from incomplete contextual information . Document all experimental conditions precisely:

    • Buffer composition differences

    • pH variations

    • Temperature differences

    • Sample preparation variations

    • Instrument calibration differences

  • Multidimensional Dependencies: Consider using a notation system for tracking contradictions with parameters (α, β, θ):

    • α: number of interdependent items

    • β: number of contradictory dependencies

    • θ: minimal number of Boolean rules needed

  • Systematic Verification:

    • Repeat experiments with controlled variables

    • Use orthogonal methods to validate findings

    • Implement statistical analyses to determine significance of differences

  • Domain-Specific Knowledge Integration:

    • Consider species variations if comparing to other dipeptidases

    • Evaluate temporal context that might explain differing results

    • Assess environmental phenomena that could influence activity

How can NECHADRAFT_87110 be compared with dipeptidases from other species for evolutionary insights?

Comparative analysis of NECHADRAFT_87110 with homologous dipeptidases offers evolutionary insights:

Comparative Analysis Methodology:

  • Sequence-Based Comparison:

    • Perform multiple sequence alignment of NECHADRAFT_87110 with dipeptidases from diverse species

    • Calculate sequence identity and similarity percentages

    • Identify conserved motifs and catalytic residues

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Structure-Based Comparison:

    • Superimpose predicted structure of NECHADRAFT_87110 with solved structures of homologous enzymes

    • Calculate RMSD (root-mean-square deviation) of backbone atoms

    • Identify structural conservation in catalytic domains versus divergence in substrate specificity regions

  • Functional Comparison:

    • Compare substrate specificity profiles across species

    • Analyze pH optima and temperature stability differences

    • Evaluate catalytic efficiency parameters (kcat/Km) for conserved substrates

Expected Evolutionary Insights:

  • Conservation patterns in catalytic residues across fungal dipeptidases

  • Potential adaptation of substrate specificity based on ecological niche

  • Correlation between structural features and enzymatic properties in different species

What are the methodological considerations for studying post-translational modifications of NECHADRAFT_87110?

Post-translational modifications (PTMs) can significantly impact enzyme function and require specialized detection methods:

PTM Analysis Workflow:

  • Prediction of Potential Modification Sites:

    • Use bioinformatic tools to predict possible glycosylation, phosphorylation, or other modification sites

    • Identify consensus sequences that match known PTM patterns

  • Mass Spectrometry-Based Detection:

    • Enzymatic digestion of NECHADRAFT_87110 using trypsin or other proteases

    • LC-MS/MS analysis of resulting peptides

    • Database searching with variable modifications enabled

    • Manual validation of PTM-containing spectra

  • Functional Impact Assessment:

    • Compare activity of native versus recombinant protein (which may lack eukaryotic PTMs)

    • Generate site-directed mutants at potential PTM sites

    • Analyze kinetic parameters before and after enzymatic removal of PTMs (e.g., PNGase F for N-glycans)

  • Expression System Considerations:

    • E. coli-expressed protein will lack most eukaryotic PTMs

    • Consider yeast or insect cell expression for closer mimicry of native modifications

    • Mammalian cell expression for complex PTM patterns if required

How can NECHADRAFT_87110 be used in studies of fungal metabolism and pathogenicity?

NECHADRAFT_87110 may play significant roles in fungal biology that could be explored through these approaches:

Research Applications:

  • Metabolic Function Studies:

    • Gene knockout/knockdown experiments to assess phenotypic changes

    • Metabolomic profiling to identify altered peptide/amino acid pools

    • Growth assays under different nutrient conditions to determine metabolic role

  • Pathogenicity Investigations:

    • Virulence assessment of wild-type versus NECHADRAFT_87110-deficient strains

    • Host-pathogen interaction studies to determine if the enzyme interfaces with host defense

    • Secretome analysis to determine if the enzyme is exported during infection

  • Inhibitor Development:

    • Design of specific inhibitors as potential antifungal candidates

    • Structure-activity relationship studies to optimize inhibitor specificity

    • In vivo testing of inhibitors in infection models

What are the considerations for comparing recombinant versus native NECHADRAFT_87110?

When comparing native and recombinant forms of the enzyme, consider these methodological approaches:

Comparative Analysis Framework:

  • Purification Strategy Considerations:

    • Native protein: Extract from Nectria haematococca cultures under conditions that preserve activity

    • Recombinant protein: Express with minimal tags to reduce interference with function

  • Property Comparison:

    • Enzymatic activity under identical conditions

    • Substrate specificity profiles

    • pH and temperature optima

    • Stability and half-life

    • Structural integrity via circular dichroism or thermal shift assays

  • Potential Differences to Investigate:

    • Post-translational modifications present in native but not recombinant protein

    • Folding variations due to expression system differences

    • Effects of purification tags on activity or specificity

    • Potential contaminating proteins in native preparations

  • Data Reconciliation:

    • Document all experimental conditions precisely to allow direct comparison

    • Consider statistical approaches to determine if differences are significant

    • Use orthogonal methods to validate key findings

How can high-throughput screening be designed to identify novel substrates for NECHADRAFT_87110?

To comprehensively characterize NECHADRAFT_87110 substrate specificity:

High-Throughput Screening Methodology:

  • Substrate Library Design:

    • Dipeptide-based chromogenic/fluorogenic compound libraries

    • Positional scanning synthetic combinatorial libraries (PS-SCLs)

    • Natural peptide fragment collections

  • Screening Assay Setup:

    • 384-well plate format for increased throughput

    • Robotic liquid handling for consistent reagent addition

    • Multimode plate reader for absorbance/fluorescence detection

    • Z'-factor determination to validate assay robustness

  • Data Analysis Framework:

    • Calculate reaction rates for each substrate

    • Generate heat maps of activity across substrate space

    • Develop structure-activity relationships

    • Cluster substrates by chemical similarity and activity profiles

  • Validation of Hit Compounds:

    • Retest top hits in dose-response format

    • Determine full kinetic parameters (Km, kcat, kcat/Km)

    • Evaluate specificity through comparison with related enzymes

    • Structural studies of enzyme-substrate complexes for high-value substrates

How might next-generation sequencing approaches enhance understanding of NECHADRAFT_87110 biological roles?

Advanced sequencing technologies offer new insights into NECHADRAFT_87110 function:

Genomic and Transcriptomic Approaches:

  • Comparative Genomics:

    • Analyze NECHADRAFT_87110 conservation across fungal species

    • Identify syntenic relationships with functionally related genes

    • Detect evidence of horizontal gene transfer or gene duplication events

  • Transcriptomics Applications:

    • RNA-Seq to determine expression patterns under different conditions

    • Single-cell RNA-Seq to assess cell-type specific expression

    • Differential expression analysis to identify co-regulated genes

  • Functional Genomics:

    • CRISPR-Cas9 based gene editing to create knockout strains

    • RNAi approaches for conditional knockdown

    • Overexpression studies to assess gain-of-function phenotypes

  • Metatranscriptomics:

    • Analyze expression in complex environmental samples

    • Study regulation during host-microbe interactions

    • Investigate expression during interspecies competition

What computational approaches can predict substrate specificity of NECHADRAFT_87110?

Advanced computational methods can provide insights into substrate preferences:

Computational Prediction Framework:

  • Machine Learning Approaches:

    • Train models using known dipeptidase-substrate interactions

    • Implement feature extraction from physicochemical properties

    • Apply convolutional neural networks to identify binding motifs

    • Validate predictions experimentally with top-ranked substrates

  • Molecular Dynamics Simulations:

    • Model enzyme-substrate interactions in explicit solvent

    • Calculate binding free energies

    • Identify key residue interactions through trajectory analysis

    • Predict effects of mutations on substrate binding

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Model transition states in catalytic mechanism

    • Calculate activation energies for different substrates

    • Predict rate-limiting steps in catalysis

    • Design transition state analogs as potential inhibitors

  • Integration with Experimental Data:

    • Refine computational models with experimental feedback

    • Develop iterative design-test-refine cycles

    • Construct quantitative structure-activity relationships (QSAR)

How can protein engineering approaches be applied to modify NECHADRAFT_87110 properties?

Protein engineering offers opportunities to create modified versions of NECHADRAFT_87110 with enhanced or novel properties:

Protein Engineering Strategies:

  • Rational Design Approaches:

    • Structure-guided mutagenesis of active site residues

    • Introduction of disulfide bonds for enhanced stability

    • Surface charge modifications for solubility improvement

    • Substrate binding pocket alterations for specificity changes

  • Directed Evolution Methods:

    • Error-prone PCR to generate variant libraries

    • DNA shuffling to recombine beneficial mutations

    • High-throughput screening or selection systems

    • Iterative rounds of mutation and selection

  • Semi-rational Approaches:

    • Saturation mutagenesis of hotspot residues

    • Combinatorial active-site saturation testing (CASTing)

    • Ancestral sequence reconstruction

    • Consensus design based on homologous sequences

  • Design Goals and Applications:

    • Enhanced thermostability for industrial applications

    • Altered substrate specificity for biotechnological applications

    • Improved expression yields in heterologous systems

    • Reduced immunogenicity for potential therapeutic applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.