Recombinant Nectria haematococca Signal peptidase complex catalytic subunit SEC11 (SEC11)

Shipped with Ice Packs
In Stock

Description

Function and Mechanism

SEC11 is a key component of the SPC, which is essential for the removal of signal peptides from precursor proteins . Signal peptides are short amino acid sequences located at the N-terminus of many newly synthesized proteins, guiding them to the ER for further processing and secretion or integration into cellular membranes . SEC11 specifically cleaves signal peptides that contain a hydrophobic alpha-helix (h-region) shorter than 18-20 amino acids .

Homologues and Functional Partners

SEC11 has several homologues and functional partners within the cell. In Saccharomyces cerevisiae, SEC11 interacts with other SPC subunits like Spc1p, Spc2p, and Spc3p . These subunits form a complex responsible for the signal peptide cleavage activity. SEC11 also interacts with proteins involved in vesicle transport and fusion, such as SEC1, SEC4, SEC9, SEC6, SEC2, and BOS1 .

  • SPC1: Subunit of the signal peptidase complex; it cleaves the signal sequence from proteins targeted to the endoplasmic reticulum .

  • SPC3: Another subunit of the signal peptidase complex that catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the secretory pathway .

  • SPC2: Functions similarly to SPC3 as a subunit of the signal peptidase complex .

  • RPB7: RNA polymerase II subunit B16; it forms a dissociable heterodimer with Rpb4p and is involved in mRNA decay processes .

  • SEC1: Involved in docking and fusion of exocytic vesicles .

  • SEC4: Essential for vesicle-mediated exocytic secretion and autophagy .

  • SEC9: Required for secretory vesicle-plasma membrane fusion .

  • SEC6: Mediates polarized targeting and tethering of post-Golgi secretory vesicles to active sites of exocytosis at the plasma membrane .

  • SEC2: Essential for post-Golgi vesicle transport and autophagy .

  • BOS1: Necessary for vesicular transport from the ER to the Golgi .

Structure and Properties

SEC11 is a relatively small protein. The protein sequence of SEC11 predicts a protein of 167 amino acids with an estimated pI of 9.5 . It contains an NH2-terminal hydrophobic region, which may function as a signal and/or membrane anchor domain . The mass of the SEC11 protein is very close to that found for two of the subunits of the canine and hen oviduct signal peptidases .

Role in Disease and Biotechnology

While specific research on Nectria haematococca SEC11's direct role in disease is limited, the general function of SEC11 homologues in other organisms highlights its importance. For example, nerve growth factor (NGF) plays a critical role in neuronal survival, differentiation, and neuroregeneration . Since SEC11 is involved in protein processing and secretion, it may indirectly impact NGF functionality and related neurological conditions .

Nectria Species and Polyketides

Nectria species are known to produce a variety of secondary metabolites, including polyketides . These compounds have diverse biological activities, such as α-glucosidase inhibitory activity . While these metabolites are not directly related to SEC11, they highlight the biochemical richness of Nectria species and their potential for biotechnological applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
SEC11; NECHADRAFT_94096; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)
Target Names
SEC11
Target Protein Sequence
MLSSLGNPRQAAAQLMNFALILSTAFMMWKGLSVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLRETEVGEVVVYNVKDKDIPIVHRVVRKFGNGDTAELLTKGDNNLSDDTELYA KGQDYLERKDIIGSVVAYMPFVGYVTILLSEHPWLKTVMLGIMGLLVVLQRE
Uniprot No.

Target Background

Function

Recombinant Nectria haematococca Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11): SEC11 is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum (ER). This signal peptide cleavage occurs during translocation (co-translationally or post-translationally) through the translocon pore into the ER.

Database Links
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Nectria haematococca SEC11 and what is its biological function?

The signal peptidase complex catalytic subunit SEC11 in Nectria haematococca is a key enzyme that belongs to the peptidase S26B family. This protein functions as the catalytic component of the signal peptidase complex (SPC), which is responsible for cleaving N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. The cleavage occurs during protein translocation through the translocon pore (either cotranslationally or post-translationally) .

SEC11's role is critical for proper protein processing in the secretory pathway. The protein is 172 amino acids in length with a molecular mass of approximately 19.2 kDa . The catalytic activity of SEC11 ensures correctly processed proteins can proceed through subsequent folding and trafficking steps, making it essential for cellular function.

What is known about Nectria haematococca as a species and its genomic characteristics?

Nectria haematococca (asexual name: Fusarium solani) is an ascomycetous fungus belonging to the "Fusarium solani species complex," which includes over 50 phylogenetic species. This fungus has remarkable biological versatility, capable of colonizing diverse environments from agricultural to non-cultivated habitats .

Key genomic and biological characteristics include:

  • Genome size: 54.43 Mb, among the largest reported for ascomycetes

  • Chromosome number: 17 chromosomes (ranging from 530 kb to 6.52 Mb)

  • Predicted genes: 15,707

  • Supernumerary chromosomes: Chromosomes 14, 15, and 17 are supernumerary, containing more repeat sequences and unique genes

  • Pathogenicity: Can cause disease in over 100 genera of plants and opportunistic infections in humans

  • Habitat diversity: Found in agricultural fields, forests, scrub communities, savannahs, prairies, swamps, coastal zones, and deserts

The fungus has a complex genome with several genes controlling habitat-specific colonization abilities located on supernumerary chromosomes. These chromosomes have a lower G+C content compared to other chromosomes and are enriched in unique and duplicated genes .

What are the optimal conditions for recombinant expression of Nectria haematococca SEC11?

Based on successful recombinant expression of similar fungal proteins, the following optimized protocol is recommended for Nectria haematococca SEC11 expression:

Expression System Design:

  • Vector choice: pET-based vectors with T7 promoter and His-tag for purification

  • Host strain: E. coli BL21(DE3) or Rosetta(DE3) for improved codon usage

  • Construct design: Consider codon optimization for E. coli

Expression Conditions:

  • Culture medium: LB or TB supplemented with appropriate antibiotics

  • Growth temperature: 37°C until OD600 reaches 0.6-0.8, then lower to 16°C for induction

  • Induction: 0.1-0.5 mM IPTG

  • Post-induction incubation: 16-20 hours at 16°C with shaking at 180-200 rpm

Purification Strategy:

  • Cell lysis via sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

  • Ni-NTA affinity chromatography

  • Size exclusion chromatography for higher purity

Following a similar protocol, researchers have achieved yields of approximately 42.7 mg/L for related recombinant proteins from Nectria haematococca . SDS-PAGE and MALDI-MS analyses can confirm successful expression and purification.

How should researchers design experiments to study the immunomodulatory properties of recombinant SEC11?

Based on previous research showing immunomodulatory effects of fungal proteins from Nectria haematococca, the following experimental design is recommended:

In Vitro Studies:

Assay TypeMethodologyMeasurementsControls
HemagglutinationSerial dilutions with human/rabbit RBCsMinimum agglutinating concentrationPositive: ConA; Negative: PBS
Lymphocyte proliferationMouse splenocytes with MTT/MTS assayStimulation index at 24, 48, 72hPositive: ConA; Negative: Unstimulated cells
Cytokine inductionELISA on culture supernatantsIL-2, IL-4, IL-10, IFN-γ levelsBaseline cytokine measurements
Flow cytometryCell surface marker analysisCD4+/CD8+ ratio, activation markersIsotype controls

In Vivo Studies:

  • Animal model selection (typically mice)

  • Dose-response experiments (typically 5-50 mg/kg)

  • Time-course analysis of immune parameters

  • Tissue collection and analysis (spleen, lymph nodes)

Data Analysis:

  • Statistical methods for dose-response relationships

  • Multivariate analysis to correlate different immune parameters

  • Comparison with known immunomodulatory compounds

Previous research has demonstrated that recombinant proteins from Nectria haematococca can significantly stimulate mouse spleen lymphocyte proliferation and enhance expression of interleukin-2 (IL-2) . These findings provide a foundation for more comprehensive immunological profiling of SEC11.

What experimental approaches can be used to investigate the antitumor effects of recombinant SEC11?

To rigorously investigate the potential antitumor effects of recombinant SEC11 from Nectria haematococca, employ the following comprehensive experimental approach:

In Vitro Cancer Cell Models:

Cell LineCancer TypeRecommended AssaysTimepoints
HL60LeukemiaCell viability, Apoptosis24, 48, 72h
HepG2Hepatocellular carcinomaCell cycle analysis, Migration24, 48, 72h
MGC823Gastric cancerColony formation, Invasion7-14 days

Mechanism of Action Studies:

  • Apoptosis pathway analysis (Annexin V/PI staining, caspase activation)

  • Cell cycle distribution (PI staining, cyclin expression)

  • Signal transduction pathways (Western blot for key oncogenic pathways)

  • Gene expression profiling (microarray or RNA-seq)

In Vivo Xenograft Models:

  • Subcutaneous implantation of responsive cancer cells in immunodeficient mice

  • Treatment regimen: 5-20 mg/kg SEC11, i.p. or i.v., 2-3 times weekly

  • Tumor volume measurements every 2-3 days

  • Terminal analyses: tumor weight, histopathology, molecular markers

Biomarker Discovery:

  • Proteomics analysis of treated versus untreated tumors

  • Identification of response predictors

  • Validation in patient-derived xenograft models

Previous research has indicated that recombinant proteins from Nectria haematococca exhibit strong antitumor effects against HL60, HepG2, and MGC823 cell lines , warranting thorough investigation into mechanisms and therapeutic potential.

How can researchers address contradictions in experimental data related to SEC11 function?

When encountering contradictory results in SEC11 functional studies, researchers should implement the following structured approach to resolve discrepancies:

Systematic Variables Assessment:

Variable CategoryFactors to ExamineStandardization Method
Expression systemsE. coli strain, vector, induction conditionsUse identical systems across labs
Protein preparationPurification method, buffer composition, storageStandardize protocols and quality control
Assay conditionsTemperature, pH, ionic strength, cofactorsPerform sensitivity analysis
Experimental designControls, replicates, randomizationImplement pre-registered protocols

Root Cause Analysis:

  • Perform detailed meta-analysis of existing literature

  • Identify potential sources of variability in methodology

  • Design critical experiments that directly address contradictions

  • Consider biological explanations (isoforms, post-translational modifications)

Collaborative Resolution:

  • Multi-laboratory validation studies

  • Sharing of reagents and protocols

  • Blind sample analysis

  • Data sharing through repositories

Reporting Recommendations:

  • Document all methodology in extreme detail

  • Report negative results alongside positive findings

  • Include raw data and detailed statistical analyses

  • Address limitations transparently

This methodological framework aligns with experimental design best practices that emphasize the need for rigorous controls and systematic evaluation of variables to establish causality .

What methodological approaches should be used to investigate the role of SEC11 in fungal pathogenicity?

To investigate SEC11's role in Nectria haematococca pathogenicity, implement this comprehensive methodological framework:

Genetic Manipulation:

  • Gene knockout using CRISPR-Cas9 or homologous recombination

  • Complementation with wild-type and mutant alleles

  • Site-directed mutagenesis of catalytic residues

  • Fluorescent protein tagging for localization studies

Virulence Assays:

Host ModelInoculation MethodAssessment ParametersTimepoints
Pea (Pisum sativum)Root dip or soil infestationDisease severity index, plant growth7, 14, 21 days
Chickpea (Cicer arietinum)Stem wound inoculationLesion length, pathogen recovery3, 7, 14 days
Immunocompromised miceSpore inhalation or injectionFungal burden, survival1-30 days

Molecular Profiling:

  • Transcriptomics of wild-type vs. SEC11 mutants during infection

  • Comparative secretome analysis using proteomics

  • Metabolite profiling of infected tissues

  • Host response characterization (defense gene expression)

Functional Analysis:

  • Protein secretion assays (quantitative and qualitative)

  • Signal peptide processing efficiency

  • Cell wall integrity and stress response

  • Substrate specificity determination

This approach capitalizes on the extensive knowledge of Nectria haematococca's pathogenicity across a wide range of hosts . The strategy combines classical plant pathology methods with modern molecular techniques to elucidate SEC11's contribution to virulence.

How can researchers analyze sequence conservation of SEC11 across fungal species?

For comprehensive SEC11 sequence conservation analysis across fungal species, implement the following methodological workflow:

Sequence Retrieval and Alignment:

  • Extract SEC11 homologs from genomic databases (NCBI, FungiDB, JGI)

  • Perform multiple sequence alignment using MUSCLE or MAFFT

  • Refine alignments manually to ensure proper alignment of catalytic residues

  • Generate conservation plots and sequence logos

Phylogenetic Analysis:

  • Select appropriate evolutionary models using ModelTest

  • Construct maximum likelihood trees with bootstrap support

  • Map species relationships to SEC11 sequence divergence

  • Identify clade-specific sequence signatures

Structure-Function Analysis:

  • Map conserved residues onto protein structural models

  • Identify catalytic site conservation versus peripheral variability

  • Analyze insertion/deletion patterns across fungal lineages

  • Predict functional consequences of sequence variations

Comparative Genomics Context:

  • Analyze synteny of SEC11 genomic regions

  • Examine promoter conservation and potential regulatory elements

  • Investigate gene duplications and paralog relationships

  • Correlate sequence conservation with ecological/pathogenic characteristics

This methodological framework will reveal evolutionary patterns of SEC11 conservation and diversification across fungi with different lifestyles, including the unique features of Nectria haematococca's SEC11 in comparison to related species like Tuber melanosporum, Pichia angusta, and others represented in the databases .

What statistical approaches are most appropriate for analyzing dose-response data in SEC11 functional studies?

When analyzing dose-response data from SEC11 functional studies, researchers should implement these statistical methodologies:

Dose-Response Curve Modeling:

Model TypeApplicationAdvantagesSoftware Implementation
Four-parameter logisticStandard sigmoid responsesProvides EC50, Hill slopeGraphPad Prism, R (drc package)
Five-parameter logisticAsymmetric responsesAccounts for curve asymmetryR (drc package)
Biphasic modelsComplex responses with multiple phasesCaptures hormetic effectsR (drc package, hormesis)

Statistical Analysis Workflow:

  • Data transformation if necessary (log transformation often appropriate)

  • Outlier identification and handling (statistical tests, not visual)

  • Model fitting with appropriate weighting (constant CV often best for biological data)

  • Parameter estimation with confidence intervals

  • Model comparison using AIC/BIC criteria

  • Lack-of-fit testing

Comparing Multiple Dose-Response Curves:

  • Parameter-specific hypothesis testing (EC50, maximum effect)

  • Global curve comparison using extra sum-of-squares F test

  • Bootstrap resampling for non-parametric comparisons

  • Bayesian hierarchical modeling for complex experimental designs

Reporting Requirements:

  • Complete methodology description (replicates, experimental units)

  • Visualization of raw data alongside fitted curves

  • Parameter estimates with confidence intervals

  • Explicit description of model constraints and assumptions

This statistical framework aligns with experimental design best practices and ensures robust interpretation of SEC11 functional data, particularly when investigating its enzymatic activity, immunomodulatory properties, or antitumor effects.

How should researchers interpret the bioactivity of recombinant SEC11 in context of signal peptidase function?

To properly interpret SEC11 bioactivity data in the context of its signal peptidase function, researchers should consider this comprehensive analytical framework:

Core Enzymatic Function Assessment:

  • Develop quantitative assays for signal peptide cleavage activity using:

    • Synthetic fluorogenic peptide substrates

    • In vitro translation systems with radiolabeled precursors

    • Mass spectrometry-based cleavage site mapping

  • Compare kinetic parameters (Km, kcat, specificity constants) with SEC11 from model organisms

Structure-Function Relationship:

  • Map bioactivity to structural domains

  • Analyze the impact of mutations on both enzymatic and non-canonical functions

  • Determine the oligomeric state required for different activities

  • Investigate potential allosteric regulation

Physiological Context Interpretation:

  • Compare in vitro activity to predicted in vivo function

  • Identify potential natural substrates in Nectria haematococca

  • Correlate signal peptidase activity with observed bioactive properties

  • Consider evolutionary context of dual-function proteins

Integration with Known Signal Peptidase Biology:

  • Compare with human SEC11 homologs (SEC11A/SEC11C)

  • Analyze conservation of catalytic mechanism

  • Evaluate potential as antimicrobial or therapeutic target

  • Differentiate between direct effects and indirect consequences of signal peptide processing

This interpretive framework accounts for the primary function of SEC11 as a signal peptidase while acknowledging its potential moonlighting functions, such as the immunomodulatory and antitumor activities observed in recombinant fungal proteins . By systematically distinguishing canonical from non-canonical activities, researchers can develop a comprehensive understanding of SEC11 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.