KEGG: ngk:NGK_1672
Neisseria gonorrhoeae Na(+)-translocating NADH-quinone reductase subunit E (NqrE) is one of the six subunits (NqrA-F) that constitute the Na(+)-translocating NADH:quinone oxidoreductase complex (Na(+)-NQR) in the bacterial respiratory chain. This membrane-bound protein complex catalyzes the oxidation of NADH while simultaneously reducing ubiquinone to ubiquinol, coupling this electron transfer reaction to the translocation of sodium ions across the cytoplasmic membrane . NqrE specifically functions as an integral membrane component of this complex with a molecular weight corresponding to its 197 amino acid sequence . The full amino acid sequence of NqrE has been determined as MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPANQLVYSLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYDFGESVVYGFGAGLGWMLAIVALAGITEK MKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL, revealing multiple hydrophobic regions consistent with its membrane-spanning nature . The protein is classified with the Enzyme Commission number EC 1.6.5.-, reflecting its oxidoreductase activity that acts on NADH with quinones as electron acceptors .
Studying NqrE in Neisseria gonorrhoeae holds considerable significance due to this organism's status as a major human pathogen. N. gonorrhoeae is the causative agent of gonorrhea, a common sexually transmitted infection for which no effective vaccine currently exists . The Na(+)-NQR complex, including NqrE, represents a unique bacterial respiratory enzyme not found in human cells, making it a potential target for antimicrobial development against this increasingly antibiotic-resistant pathogen . Research into NqrE contributes to our fundamental understanding of N. gonorrhoeae metabolism and energy production, which could reveal vulnerabilities in the pathogen's survival mechanisms. Additionally, comparative studies between NqrE and homologous proteins in other pathogenic bacteria could provide insights into common mechanisms that might be exploited for broad-spectrum therapeutic approaches. The availability of recombinant NqrE protein enables detailed structural and functional analyses that could guide structure-based drug design efforts targeting this critical bacterial enzyme . Furthermore, understanding the role of NqrE in membrane potential generation may illuminate how this pathogen maintains energy homeostasis during infection and colonization of human tissues.
The structure of Neisseria gonorrhoeae NqrE shares significant homology with corresponding subunits in Na(+)-NQR complexes from other bacterial species, particularly those within the Proteobacteria phylum. While no crystal structure of N. gonorrhoeae NqrE has been specifically reported in the search results, structural analysis can be inferred from homologous proteins and sequence analysis . The NqrE subunit typically contains multiple transmembrane helices that anchor it firmly in the bacterial membrane, with specific residues that participate in forming the sodium ion channel . Comparison with NADH:quinone oxidoreductase systems reveals that bacteria possess three distinct types: the proton-pumping Complex I (NDH I), the non-electrogenic NADH:quinone oxidoreductases (NDH II), and the Na(+)-translocating NADH:quinone oxidoreductases (Na(+)-NQR) . The Na(+)-NQR complex, including NqrE, represents a unique sodium-translocating enzyme that differs substantially from the mitochondrial Complex I found in eukaryotes. Sequence analysis of the NqrE protein shows conserved hydrophobic regions that likely form transmembrane domains, with specific charged residues positioned to facilitate ion movement across the membrane . These structural features distinguish Na(+)-NQR components from other quinone reductases, such as the NADPH-dependent quinone oxidoreductase (QOR) from Phytophthora capsici, which adopts a different fold with distinct substrate binding mechanisms .
The optimal conditions for recombinant expression of Neisseria gonorrhoeae NqrE protein involve careful consideration of expression systems, vectors, and purification strategies due to its nature as a transmembrane protein. Based on available data, successful expression has been achieved in E. coli expression systems using vectors that incorporate N-terminal His-tags for subsequent purification . When expressing NqrE, researchers should consider using E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), which are better tolerate the potentially toxic effects of overexpressing membrane proteins. The expression vector should contain strong but controllable promoters, such as the T7 promoter with lac operator control, allowing for induction with IPTG at concentrations typically ranging from 0.1 to 1.0 mM. Temperature optimization is crucial, with lower temperatures (16-25°C) often yielding better results for membrane proteins compared to standard 37°C expression, as this reduces inclusion body formation and improves proper membrane insertion. For optimal results, expression media should be supplemented with appropriate antibiotics for plasmid selection, and induction should occur during mid-log phase growth (OD600 of approximately 0.6-0.8). Addition of membrane-stabilizing agents such as glycerol (5-10%) to the culture medium can enhance proper folding of the protein, while the presence of mild detergents during cell lysis and purification is essential for maintaining the native conformation of this transmembrane protein.
Purification of recombinant Neisseria gonorrhoeae NqrE protein presents significant challenges due to its hydrophobic transmembrane nature, requiring specialized approaches to maintain protein stability and functionality. The most effective purification strategy begins with immobilized metal affinity chromatography (IMAC) taking advantage of the N-terminal His-tag that has been successfully incorporated into recombinant expressions of this protein . For optimal results, cell lysis should be performed in the presence of appropriate detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration to solubilize the membrane without denaturing the protein. Purification buffers should typically contain 20-50 mM Tris-HCl or HEPES at pH 7.5-8.0, 150-300 mM NaCl, 5-10% glycerol, and the selected detergent at concentrations of 0.02-0.05% for DDM or equivalent for other detergents. Following initial IMAC purification, size exclusion chromatography (SEC) serves as an effective second purification step to remove aggregates and improve sample homogeneity, ideally using columns specifically designed for membrane protein purification. For applications requiring higher purity, ion exchange chromatography may be employed as an intermediate step between IMAC and SEC, with careful optimization of salt gradients to maintain protein stability in the presence of detergents. Throughout the purification process, the protein should be maintained at 4°C to minimize degradation, and reducing agents such as 1-5 mM DTT or 2-mercaptoethanol should be included in all buffers if the protein contains free cysteine residues that might form inappropriate disulfide bonds.
Verifying the functional activity of purified recombinant Neisseria gonorrhoeae NqrE presents a complex challenge since this protein functions as part of the larger Na(+)-NQR complex rather than as an individual enzyme. Researchers should employ multiple complementary approaches to assess both the structural integrity and potential functional capacity of the purified protein. Circular dichroism (CD) spectroscopy can provide crucial information about secondary structure content, verifying that the purified protein maintains its expected structural characteristics with appropriate alpha-helical content typical of membrane proteins. Thermal shift assays using fluorescent dyes like SYPRO Orange can assess protein stability under various buffer conditions, helping optimize storage and handling parameters. For more direct functional assessment, reconstitution of NqrE into proteoliposomes or nanodiscs together with other Na(+)-NQR subunits may allow measurement of NADH oxidation coupled to sodium transport using spectrophotometric methods to monitor NADH consumption (absorbance decrease at 340 nm) or using sodium-sensitive fluorescent indicators to detect sodium ion movements across the reconstituted membrane. Alternatively, researchers can perform binding assays with known interaction partners from the Na(+)-NQR complex using techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) to verify that the purified NqrE maintains its ability to form appropriate protein-protein interactions. Finally, structural verification through negative-stain electron microscopy can confirm that the protein adopts the expected size and shape, while mass spectrometry approaches can verify the intact mass and post-translational modifications of the purified protein.
When designing mutagenesis experiments involving Neisseria gonorrhoeae NqrE, researchers must carefully consider several key factors to ensure meaningful results that advance understanding of this transmembrane protein's structure-function relationships. First, researchers should conduct thorough sequence alignment analyses across multiple bacterial species to identify highly conserved residues that likely play crucial functional or structural roles, similar to approaches used for other oxidoreductases . Transmembrane topology prediction should be performed to map the membrane-spanning regions and identify residues likely to participate in sodium ion coordination, helping target mutations to functionally relevant positions rather than structurally stabilizing ones. Site-directed mutagenesis should focus on charged residues within or near transmembrane domains that may participate in ion translocation, as well as conserved residues at subunit interfaces that could impact complex assembly. When designing mutagenesis primers, researchers should follow standard guidelines for primer design including appropriate melting temperatures (typically 78-82°C), minimal secondary structure formation, and terminal G/C bases to enhance binding stability. For expression of mutant proteins, conditions may need to be re-optimized from those established for wild-type protein, as mutations can significantly impact expression levels, membrane insertion efficiency, and protein stability. Phenotypic characterization of mutants should employ multiple complementary assays including growth curve analysis under various sodium concentrations, membrane potential measurements, and NADH oxidation activity measurements to comprehensively assess the impact of mutations on both structure and function. Finally, researchers should consider using progressive approaches such as alanine-scanning mutagenesis of specific regions followed by more targeted substitutions (e.g., conservative vs. non-conservative) to dissect the precise contributions of individual residues to protein function.
Structural studies of Neisseria gonorrhoeae NqrE can significantly contribute to drug development strategies by providing detailed molecular insights into potential druggable sites within this essential bacterial membrane protein. As N. gonorrhoeae continues to develop alarming antibiotic resistance patterns, the Na(+)-NQR complex represents an attractive novel target for antimicrobial development since it plays a crucial role in bacterial energy metabolism and has no direct human homolog . High-resolution structural information obtained through techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy of detergent-solubilized or nanodisc-reconstituted NqrE would reveal binding pockets that could be targeted by small molecule inhibitors. Molecular dynamics simulations based on structural data could identify transient binding pockets not immediately apparent in static structures, particularly those related to the dynamic process of ion translocation. Structure-based virtual screening campaigns could leverage structural information to identify compounds predicted to bind to critical regions of NqrE, such as sites involved in interaction with other Na(+)-NQR subunits or regions essential for sodium ion coordination. Fragment-based drug discovery approaches might be particularly effective, allowing the identification of molecular fragments that bind to different pockets within NqrE that could later be linked to create high-affinity inhibitors. Additionally, structural comparison between NqrE proteins from different bacterial pathogens could guide the development of broad-spectrum agents that target conserved features while maintaining specificity for bacterial over human proteins. The development of NqrE inhibitors could potentially overcome existing resistance mechanisms since this target is distinct from those affected by current antibiotics, offering new options for treating multi-drug resistant N. gonorrhoeae infections.
The role of NqrE as part of the Na(+)-NQR complex in Neisseria gonorrhoeae pathogenesis and host interaction represents an intriguing yet understudied aspect that merits further investigation. While the primary function of the Na(+)-NQR complex is energy transduction through respiratory electron transport coupled to sodium translocation, this process may indirectly influence multiple virulence attributes of this pathogen . The Na(+) gradient generated by the Na(+)-NQR complex likely powers various secondary transporters responsible for nutrient acquisition and toxic compound efflux, potentially enhancing bacterial survival within the challenging host environment. During infection, N. gonorrhoeae must adapt to various microenvironments with different pH levels and oxygen availability, conditions under which the Na(+)-NQR complex might provide metabolic flexibility compared to strictly proton-motive force dependent respiratory systems. The maintenance of appropriate intracellular sodium levels through Na(+)-NQR activity could influence the expression and function of other virulence factors, such as adhesins like the N. gonorrhoeae adhesin complex protein (Ng-ACP), which has been investigated as a potential vaccine candidate . Additionally, as an integral membrane complex, Na(+)-NQR components including NqrE might contribute to membrane architecture and stability, potentially affecting outer membrane vesicle formation, a process important for delivering virulence factors and modulating host immune responses. Comparative studies of wild-type N. gonorrhoeae strains versus those with altered NqrE expression could reveal phenotypic differences in adherence to epithelial cells, survival within neutrophils, biofilm formation, and resistance to host-derived antimicrobial peptides—all critical aspects of the pathogenesis of this obligate human pathogen.
The Na(+)-NQR complex containing NqrE represents a distinctive bacterial respiratory enzyme with several unique features that differentiate it from other respiratory complexes. Unlike the widely distributed Complex I (NADH:ubiquinone oxidoreductase), which couples electron transfer to proton translocation, the Na(+)-NQR complex specifically translocates sodium ions across the bacterial membrane during the electron transfer process from NADH to ubiquinone . This fundamental difference in coupling ion specificity reflects distinct evolutionary adaptations and potentially provides metabolic advantages in specific environments, particularly those with varying pH but consistent sodium availability. From a structural perspective, Na(+)-NQR complexes typically contain six subunits (NqrA-F) with a total molecular mass of approximately 200 kDa, substantially smaller than the approximately 550 kDa proton-translocating Complex I with its 14 or more subunits . The cofactor composition also differs significantly—while Complex I contains multiple iron-sulfur clusters as electron carriers, the Na(+)-NQR complex employs a unique set of prosthetic groups including FAD, FMN, and riboflavin, along with iron-sulfur centers . From an energetic standpoint, the sodium-motive force generated by Na(+)-NQR can be utilized directly by sodium-dependent transporters and flagellar motors without the need for sodium/proton antiporters that would be required if only proton-motive force were available. Additionally, the Na(+)-NQR complex shows distinct inhibitor sensitivity compared to proton-pumping Complex I, being unaffected by classic Complex I inhibitors like rotenone but sensitive to specific compounds such as korormicin and 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO). These differences collectively highlight the unique nature of the Na(+)-NQR complex and its potential as a specific antimicrobial target in pathogens like N. gonorrhoeae that utilize this system.
Investigating the interactions between NqrE and other subunits of the Na(+)-NQR complex requires sophisticated techniques that can capture both stable and transient protein-protein interactions within this membrane-embedded respiratory complex. Crosslinking mass spectrometry (XL-MS) represents a powerful approach where chemical crosslinkers of defined length can capture interactions between NqrE and neighboring subunits, with subsequent mass spectrometric analysis identifying specific residues in close proximity, thus mapping interaction interfaces at the amino acid level. Förster resonance energy transfer (FRET) experiments using recombinant NqrE and other subunits labeled with appropriate fluorophore pairs can provide dynamic information about subunit proximity and conformational changes during the catalytic cycle, particularly if performed in reconstituted proteoliposomes that mimic the native membrane environment. Co-immunoprecipitation studies using antibodies against NqrE can pull down interacting partners from solubilized N. gonorrhoeae membranes, while reciprocal experiments using antibodies against other Nqr subunits can confirm these interactions and potentially identify differential association under varying conditions such as substrate availability or sodium concentration. Surface plasmon resonance (SPR) or biolayer interferometry (BLI) using immobilized NqrE can quantitatively measure binding kinetics and affinity constants for interactions with other purified Nqr subunits, providing thermodynamic parameters that describe the strength of these associations. For structural characterization of subunit interactions, cryo-electron microscopy of the intact Na(+)-NQR complex can reveal the spatial arrangement of subunits including NqrE, while hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of NqrE that become protected upon complex formation, indicating interaction interfaces. Genetic approaches such as bacterial two-hybrid screening or suppressor mutation analysis can complement these biophysical techniques by identifying functionally important interactions in vivo, potentially revealing previously unknown interaction partners beyond the canonical Nqr subunits.
The transmembrane topology of Neisseria gonorrhoeae NqrE has been primarily predicted through computational analyses and comparison with homologous proteins, as detailed structural data specifically for the N. gonorrhoeae protein is limited. Based on its amino acid sequence and hydrophobicity profile, NqrE is predicted to contain multiple transmembrane helices that anchor it within the bacterial cytoplasmic membrane . The full sequence analysis reveals a predominance of hydrophobic residues arranged in segments of appropriate length to span the membrane bilayer, consistent with its role as an integral membrane component of the Na(+)-NQR complex . Computational topology prediction algorithms typically identify 5-6 transmembrane helices in NqrE proteins, with both N and C termini likely positioned on the cytoplasmic side of the membrane. The transmembrane segments are particularly rich in aliphatic amino acids like leucine, isoleucine, and valine, which facilitate membrane integration through hydrophobic interactions with membrane lipids. Between these transmembrane segments, NqrE contains short hydrophilic loops of varying lengths that connect the helices and may participate in interactions with other Na(+)-NQR subunits or with substrates. Certain conserved polar or charged residues within the transmembrane regions likely play crucial roles in sodium ion coordination and translocation, as has been observed in other sodium-transporting membrane proteins. The predicted membrane topology of NqrE positions it optimally for its dual functions: participating in electron transfer through proximity to redox centers in other subunits, and contributing to the formation of the sodium translocation pathway through the membrane.
The amino acid sequence of Neisseria gonorrhoeae NqrE contains specific features that directly contribute to its function within the Na(+)-NQR complex. Analysis of the 197-amino acid sequence reveals a protein rich in hydrophobic residues arranged in patterns typical of transmembrane helices, which anchor the protein in the bacterial membrane and contribute to the formation of the sodium ion translocation pathway . Particularly noteworthy is the presence of conserved charged and polar residues within or adjacent to these transmembrane regions, which likely participate directly in coordinating sodium ions during the transport process. The sequence (MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPANQLVYSLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYDFGESVVYGFGAGLGWMLAIVALAGITEK MKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL) contains specific motifs likely involved in protein-protein interactions with other Na(+)-NQR subunits, ensuring proper complex assembly and stability . Several aromatic residues (phenylalanine, tyrosine, tryptophan) positioned near the membrane-water interface likely help anchor and orient the protein correctly within the lipid bilayer through interactions with membrane phospholipid headgroups. The positioning of glycine residues within transmembrane segments may provide flexibility required for conformational changes during the catalytic cycle, while conserved proline residues could introduce kinks in transmembrane helices that create the three-dimensional structure needed for ion translocation. Comparative sequence analysis across bacterial species reveals certain highly conserved residues that likely play essential roles in either the structural integrity of NqrE or its specific function in electron transfer and sodium translocation, making these residues prime targets for site-directed mutagenesis studies aiming to elucidate structure-function relationships.
Determining the crystal structure of Neisseria gonorrhoeae NqrE presents numerous experimental challenges characteristic of membrane protein crystallography, explaining why high-resolution structural data for this specific protein remains limited. The primary challenge stems from NqrE's highly hydrophobic nature with multiple transmembrane segments, requiring specialized detergents or other membrane-mimetic environments to maintain protein stability and native conformation during purification and crystallization . Obtaining sufficient quantities of properly folded protein represents a significant hurdle, as membrane proteins typically express at lower levels than soluble proteins, and a substantial fraction often misfolds or aggregates during heterologous expression. The selection of appropriate detergents is critical yet complex, requiring extensive screening as different detergents vary in their ability to extract, stabilize, and maintain the functional state of membrane proteins without inducing conformational changes that might affect crystallization. Even with optimized purification, membrane proteins typically exhibit conformational heterogeneity that can hinder crystal formation, particularly if the protein undergoes distinct conformational states as part of its normal function in sodium translocation. Crystallization itself presents additional challenges, as the detergent micelle surrounding the hydrophobic regions of NqrE can interfere with crystal contacts, requiring careful optimization of crystallization conditions or alternative approaches such as lipidic cubic phase crystallization. An additional complication arises from the fact that NqrE naturally functions as part of the larger Na(+)-NQR complex, and isolation of the individual subunit might result in conformational states that do not accurately represent its native structure within the assembled complex. These challenges collectively explain why researchers might turn to alternative structural determination methods such as cryo-electron microscopy, particularly for studying NqrE in the context of the intact Na(+)-NQR complex.
The impact of post-translational modifications on Neisseria gonorrhoeae NqrE function and stability represents an important yet incompletely characterized aspect of this protein's biology. Based on studies of homologous Na(+)-NQR complexes in other bacterial species, several potential modifications might occur that could significantly influence protein function. Phosphorylation of specific serine, threonine, or tyrosine residues within NqrE could modulate protein-protein interactions with other Na(+)-NQR subunits or influence the kinetics of conformational changes during the catalytic cycle. Given NqrE's role in a respiratory complex, oxidative modifications such as carbonylation of susceptible amino acid side chains might occur under conditions of oxidative stress, potentially altering protein function and serving as markers of respiratory chain dysfunction. As an integral membrane protein, NqrE might undergo lipid modifications that enhance membrane association or regulate interaction with specific lipid microdomains in the bacterial membrane. The presence of cysteine residues in the NqrE sequence suggests potential for disulfide bond formation or other thiol-based modifications that could impact protein stability and function, particularly under varying redox conditions encountered during infection. Precise mapping of post-translational modifications would require sophisticated mass spectrometry approaches applied to carefully purified native protein rather than recombinant material, as some modifications might be specific to the native N. gonorrhoeae cellular environment. Comparative analysis of modification patterns between actively growing bacteria versus those under stress conditions might reveal regulatory mechanisms that adjust Na(+)-NQR function in response to environmental challenges. Additionally, site-directed mutagenesis of residues subject to modification would provide direct evidence of their functional significance, potentially revealing new regulatory mechanisms governing this important respiratory complex.