Recombinant Neisseria gonorrhoeae Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Neisseria gonorrhoeae Na⁺-translocating NADH-quinone reductase subunit E (nqrE) is a purified protein derived from the nqrE gene of Neisseria gonorrhoeae, a pathogenic bacterium causing gonorrhea. This subunit is part of the Na⁺-NQR complex, a multi-subunit enzyme critical for bacterial electron transport and sodium ion translocation . The recombinant form is engineered to retain structural and functional properties of the native protein for research and diagnostic applications .

Molecular Structure

  • Amino Acid Sequence: The recombinant protein spans 197 residues (1–197 aa), with a sequence:
    MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPANQLVYSLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYDFGESVVYGFGAGLGWmLAIVALAGITEKMKYSDAPKGLKGLGITFI AAGLMAMAFMSFSGIQL .

  • Protein Tags: The tag type (e.g., His-tag, GST) is determined during production to optimize solubility and purification .

  • Storage Buffer: Tris-based buffer with 50% glycerol, stored at -20°C or -80°C .

Functional Role

The Na⁺-NQR complex couples NADH oxidation to ubiquinone reduction, generating a sodium motive force (Na⁺ gradient) across the membrane. This gradient drives ATP synthesis via ATP synthase . Subunit E (nqrE) is essential for:

  • Electron Transfer: Facilitating the flow of electrons from NADH to ubiquinone.

  • Proton/Na⁺ Translocation: Contributing to ion translocation, though the exact mechanism remains under study .

Diagnostic Tools

Recombinant nqrE is used in ELISA kits to detect antibodies against N. gonorrhoeae. These kits aid in serological studies and vaccine development .

ParameterDetails
Product TypeRecombinant protein
Species StrainATCC 700825 / FA 1090 (Q5F6X6) or NCCP11945 (B4RNG2)
ApplicationsAntibody detection, vaccine research, enzymatic assays
Storage-20°C or -80°C; avoid repeated freeze-thaw cycles

Therapeutic and Mechanistic Studies

  • Antimicrobial Targets: nqrE is a candidate for developing inhibitors targeting the Na⁺-NQR complex, which is critical for N. gonorrhoeae survival under anaerobic conditions .

  • Oxidative Stress: Na⁺-NQR contributes to superoxide production via FAD cofactors in Vibrio cholerae . Similar mechanisms in N. gonorrhoeae may influence pathogen-host interactions.

Comparative Analysis of Strains

StrainUniProt IDGene LocusKey Features
ATCC 700825 / FA 1090Q5F6X6NGO1417Primary strain for recombinant nqrE production
NCCP11945B4RNG2NGK_1672Alternative strain with distinct genetic context

Challenges and Future Directions

  • Production Hurdles: Maintaining quaternary structure and enzymatic activity in recombinant nqrE is challenging due to its dependence on other Na⁺-NQR subunits .

  • Immune Evasion: While nqrE is not directly linked to immune evasion mechanisms (e.g., LOS sialylation, PorB), its role in energy metabolism may indirectly influence N. gonorrhoeae persistence .

  • Vaccine Potential: Subunit E is less studied compared to antigens like Ng-ACP , but its conserved expression across strains (e.g., FA1090, NCCP11945) suggests potential as a diagnostic marker .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; NGO1417; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Target Names
nqrE
Target Protein Sequence
MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPANQLVY SLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCA IFGAVSFMAQREYDFGESVVYGFGAGLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFI AAGLMAMAFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: ngo:NGO1417

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Na (+)-translocating NADH-quinone reductase in Neisseria gonorrhoeae?

The Na (+)-translocating NADH-quinone reductase (Na+-NQR) in N. gonorrhoeae is a respiratory complex that couples the oxidation of NADH to the reduction of ubiquinone while simultaneously translocating sodium ions across the cytoplasmic membrane. This process generates an electrochemical gradient that drives essential cellular processes like ATP synthesis, nutrient uptake, and maintenance of internal pH. In respiratory chains of bacteria, this oxidation-reduction coupling builds up the electrochemical gradient necessary for energy conservation and cellular function . The Na+-NQR complex represents a distinct evolutionary pathway from the H+-translocating Complex I found in mitochondria and many bacteria, making it a unique feature of certain bacterial respiratory systems, including pathogens like N. gonorrhoeae .

What structural features characterize recombinant nqrE from N. gonorrhoeae?

The recombinant nqrE subunit from N. gonorrhoeae is expected to contain transmembrane domains characteristic of membrane proteins involved in ion translocation. While specific structural data for N. gonorrhoeae nqrE is not extensively documented in the current literature, structural studies on Na+-NQR from V. cholerae using cryo-EM and X-ray crystallography have revealed that the complex undergoes significant conformational changes during the catalytic cycle . These conformational changes couple electron transfer to ion translocation. Researchers working with recombinant nqrE should consider its hydrophobic nature and the potential presence of cofactor binding sites when designing expression and purification protocols.

What expression systems are most effective for producing recombinant N. gonorrhoeae nqrE?

For the expression of recombinant N. gonorrhoeae nqrE, researchers should consider the following methodological approaches:

  • E. coli-based expression systems: Modified strains such as C41(DE3) or C43(DE3) that are optimized for membrane protein expression should be considered. These strains contain mutations that prevent the toxicity often associated with overexpression of membrane proteins.

  • Expression vectors: Vectors containing strong, inducible promoters (T7, tac) with appropriate fusion tags (His6, MBP, or SUMO) can facilitate both expression and subsequent purification. The inclusion of a cleavable tag is advisable for functional studies where the native protein is required.

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often yield better folding of membrane proteins. A typical protocol might involve induction at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG, followed by expression at 18°C for 16-20 hours.

Drawing from approaches used for other recombinant N. gonorrhoeae proteins like Ng-ACP, researchers should optimize codon usage for the expression host and consider the addition of chaperone co-expression plasmids to improve folding .

What are the optimal purification strategies for recombinant nqrE?

Purification of recombinant nqrE requires careful consideration of its membrane protein nature:

  • Membrane extraction: Solubilization of membranes using appropriate detergents (DDM, LMNG, or CHAPS) at concentrations above their critical micelle concentration is essential. A multi-detergent screening approach is recommended to identify optimal solubilization conditions.

  • Chromatography sequence:

    • Initial capture using affinity chromatography (IMAC for His-tagged constructs)

    • Intermediate purification via ion exchange chromatography

    • Final polishing step using size exclusion chromatography

  • Buffer optimization: Maintaining protein stability throughout purification requires buffers containing detergent at concentrations above CMC, potentially supplemented with glycerol (10-15%) and stabilizing agents like cholesteryl hemisuccinate.

For functional studies, researchers should verify that the purification process maintains the native conformation of nqrE, potentially by incorporating functional assays at different purification stages.

How can researchers assess the quality and integrity of purified recombinant nqrE?

Multiple complementary techniques should be employed to assess the quality of purified recombinant nqrE:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (>95% purity target)

    • Western blotting using anti-His or specific anti-nqrE antibodies

  • Structural integrity:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Thermal shift assays to evaluate protein stability under different buffer conditions

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state and homogeneity

  • Functional verification:

    • Binding assays with known cofactors

    • Reconstitution experiments with other Na+-NQR subunits to assess complex formation capacity

The successful expression and purification of other N. gonorrhoeae membrane proteins have demonstrated that obtaining functionally active recombinant membrane proteins from this organism is feasible with optimized protocols .

What experimental methods can be used to measure the activity of recombinant nqrE?

The functional characterization of recombinant nqrE requires both isolated subunit assessments and reconstitution approaches:

  • Electron transfer capacity:

    • Spectrophotometric assays monitoring the reduction/oxidation of electron carriers

    • Oxygen consumption measurements in reconstituted systems

    • Potentiometric titrations to determine redox potentials

  • Sodium transport activity:

    • 22Na+ uptake assays in proteoliposomes

    • Sodium-dependent fluorescent probes to monitor ion translocation

    • Electrophysiological measurements in reconstituted membranes

  • Cofactor binding studies:

    • Isothermal titration calorimetry (ITC) to determine binding constants

    • Fluorescence spectroscopy for flavin cofactors

    • EPR spectroscopy for iron-sulfur clusters

It's important to note that full functional activity will likely require the complete Na+-NQR complex, so assessing nqrE's contribution may involve reconstitution with other subunits or complementation studies in mutant strains.

How does the nqrE subunit participate in the electron transfer mechanism?

Based on studies of Na+-NQR in related systems, the electron transfer pathway likely involves:

  • Initial electron acceptance: NADH donates electrons to FAD in the NqrF subunit .

  • Electron transport chain: Electrons are shuttled through a series of cofactors including FMN and iron-sulfur clusters across the membrane.

  • nqrE's role: While specific details for N. gonorrhoeae nqrE are not fully characterized in the available literature, by analogy with other Na+-NQR systems, nqrE likely contains binding sites for cofactors involved in the electron transport chain and forms part of the conformational change mechanism that couples electron transfer to ion translocation.

  • Terminal electron transfer: The final electron acceptor is ubiquinone, completing the electron transport pathway.

The precise role of nqrE should be investigated through site-directed mutagenesis of predicted cofactor binding sites, followed by functional assays to determine the impact on electron transfer efficiency.

What techniques are available for studying the conformational changes in nqrE during the catalytic cycle?

Several biophysical techniques can provide insights into the conformational dynamics of nqrE:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map regions of the protein that undergo conformational changes during the catalytic cycle by measuring the rate of hydrogen-deuterium exchange.

  • Single-molecule FRET: By introducing fluorescent labels at strategic positions, researchers can monitor distance changes between domains during catalysis.

  • Cryo-EM analysis: As demonstrated with the V. cholerae Na+-NQR, cryo-EM can capture different conformational states during the catalytic cycle . Applying this approach to the N. gonorrhoeae complex could reveal nqrE's specific conformational changes.

  • Molecular dynamics simulations: Computational approaches can predict how nqrE responds to electron transfer events and interacts with other subunits.

These methods should be employed under different conditions (varying substrate concentrations, presence/absence of sodium, different redox states) to build a comprehensive model of nqrE's conformational cycle.

How does nqrE interact with other subunits in the Na+-NQR complex?

Understanding the interactions between nqrE and other subunits requires multiple complementary approaches:

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry analysis can identify interaction interfaces between nqrE and other subunits.

  • Co-immunoprecipitation experiments: Using antibodies against nqrE or other subunits to pull down interaction partners.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can confirm direct interactions between nqrE and other subunits.

  • Structural biology approaches: Cryo-EM studies of the complete complex can reveal the positioning of nqrE relative to other subunits and identify interaction interfaces.

Based on Na+-NQR studies in other bacteria, nqrE likely forms critical contacts with adjacent membrane subunits that are essential for both structural integrity and the coordinated conformational changes required for ion translocation .

What are the key methodological considerations for studying Na+-NQR complex assembly?

Investigating the assembly of the Na+-NQR complex requires careful experimental design:

  • Sequential deletion studies: Expressing the complex with individual subunits removed can reveal assembly dependencies and subcomplex formation.

  • Pulse-chase experiments: These can track the temporal sequence of subunit incorporation during complex assembly.

  • In vitro reconstitution: Purifying individual subunits and attempting stepwise reconstitution can identify critical assembly intermediates.

  • Native gel electrophoresis: Blue native PAGE or clear native PAGE can resolve subcomplexes formed during assembly or when specific subunits are absent.

  • Time-resolved cryo-EM: This emerging technique could potentially capture assembly intermediates at different stages.

Researchers should consider that membrane protein complex assembly may require specific lipids or chaperones that must be included in reconstitution experiments.

How does N. gonorrhoeae nqrE compare to homologous proteins in other bacterial species?

Comparative analysis of nqrE across bacterial species reveals important evolutionary patterns:

  • Sequence conservation: Multiple sequence alignment of nqrE from diverse bacteria shows:

    • Highly conserved regions likely represent functional domains involved in cofactor binding or ion translocation

    • Variable regions may reflect adaptation to different physiological niches

  • Structural comparison: Homology modeling based on available structures (such as the V. cholerae Na+-NQR) can highlight conserved structural elements and species-specific variations .

  • Functional diversity: Different bacterial species may show variations in:

    • Sodium versus proton specificity

    • Quinone substrate preference

    • Regulatory mechanisms controlling expression

These comparative analyses can guide experimental design by identifying conserved residues for targeted mutagenesis and suggesting potential functional differences specific to N. gonorrhoeae.

What can we learn from studying nqrE across different Neisseria species?

Comparative analysis within the Neisseria genus offers unique insights:

  • Pathogenic vs. commensal species: Comparing nqrE between pathogenic (N. gonorrhoeae, N. meningitidis) and commensal Neisseria species can reveal adaptations associated with pathogenicity.

  • Expression regulation: Different Neisseria species may regulate nqrE expression through distinct mechanisms. For example, the iron-dependent regulation observed for other N. gonorrhoeae proteins might also apply to nqrE .

  • Evolutionary pressure: Analysis of selection pressures (dN/dS ratios) on nqrE across Neisseria species can identify regions under positive selection that might contribute to host adaptation.

The high conservation observed for other proteins across Neisseria species, such as the OmpA protein and NceR regulator, suggests that functional elements of nqrE may also be highly conserved within this genus .

Why is Na+-NQR considered a potential target for novel antimicrobials against N. gonorrhoeae?

The Na+-NQR complex possesses several attributes that make it an attractive antimicrobial target:

  • Essential function: The Na+-NQR complex plays a critical role in bacterial energy metabolism, making it essential for survival under physiological conditions.

  • Structural uniqueness: Na+-NQR is found exclusively in bacteria and is absent in humans, reducing the risk of off-target effects .

  • Conservation in pathogens: The presence of Na+-NQR in multiple pathogenic bacteria, including drug-resistant strains, makes it a broad-spectrum target .

  • Increasing antibiotic resistance: With rising antibiotic resistance in N. gonorrhoeae strains, new targets like Na+-NQR are urgently needed .

Targeting nqrE specifically could disrupt both complex assembly and function, providing a novel approach to combat increasingly drug-resistant N. gonorrhoeae infections.

What methodological approaches can be used to identify inhibitors of nqrE function?

A comprehensive inhibitor discovery pipeline would include:

  • High-throughput screening approaches:

    • Biochemical assays measuring NADH oxidation or quinone reduction

    • Whole-cell growth inhibition assays with counterscreens in Na+-NQR-deficient strains

    • Fragment-based screening using thermal shift assays or surface plasmon resonance

  • Structure-based drug design:

    • Virtual screening against binding pockets identified in structural models

    • Molecular docking of compound libraries

    • Rational design of competitive inhibitors for cofactor binding sites

  • Phenotypic screening:

    • Membrane potential-sensitive dyes to identify compounds that dissipate the sodium gradient

    • Respiratory activity assays in intact cells

  • Target validation:

    • Resistant mutant generation and whole-genome sequencing

    • Overexpression studies to confirm mechanism of action

    • Biochemical assays with purified components to confirm direct interaction

The successful identification of lysozyme inhibitor activity in other N. gonorrhoeae proteins suggests that rational approaches targeting specific protein functions can be effective .

How might nqrE contribute to antibiotic resistance mechanisms in N. gonorrhoeae?

The potential involvement of nqrE in antibiotic resistance could manifest through several mechanisms:

  • Energy-dependent efflux pumps: The sodium gradient generated by Na+-NQR can power efflux pumps that extrude antibiotics from the cell. Variations in nqrE that enhance Na+ translocation efficiency might indirectly increase efflux pump activity.

  • Metabolic adaptation: Changes in respiratory chain function via nqrE modifications could enable metabolic adaptations that contribute to antibiotic tolerance or persistence.

  • Membrane potential regulation: Alterations in sodium gradient maintenance through modified nqrE function might affect membrane potential, influencing the uptake and efficacy of certain antibiotics.

  • Regulatory networks: As seen with other N. gonorrhoeae proteins, nqrE expression might be linked to regulatory networks that respond to environmental stresses, including antibiotics .

Experimental approaches to investigate these possibilities include:

  • Comparative proteomics of resistant versus susceptible strains focusing on nqrE expression

  • Genetic manipulation of nqrE expression levels combined with antibiotic susceptibility testing

  • Membrane potential measurements in strains with modified nqrE

What role might nqrE play in the pathogenesis and host adaptation of N. gonorrhoeae?

The potential contributions of nqrE to pathogenesis include:

  • Energy provision during infection: The Na+-NQR complex may be crucial for generating energy under the specific conditions encountered during infection.

  • Adaptation to host microenvironments: The sodium-pumping activity might be advantageous in the sodium-rich environments of the human host.

  • Stress response coordination: Similar to other proteins in N. gonorrhoeae, nqrE may be integrated into regulatory networks that respond to host-derived stresses .

  • Indirect effects on virulence factor expression: Changes in cellular energetics via nqrE could influence the expression of classical virulence factors.

Research approaches to explore these possibilities include:

  • Infection models comparing wild-type and nqrE-modified strains

  • Transcriptomic analysis under conditions mimicking different infection sites

  • Metabolic profiling during host cell interaction

  • Evaluation of nqrE expression during different stages of infection

How do environmental factors and host conditions regulate nqrE expression and function?

The regulation of nqrE expression and function likely responds to multiple environmental signals:

  • Oxygen availability: As a respiratory complex component, nqrE expression may be regulated in response to oxygen levels.

  • Iron availability: Similar to other N. gonorrhoeae proteins like OmpA, nqrE expression might be regulated by iron availability through specific transcriptional regulators like NceR .

  • pH and ion concentrations: Changes in environmental pH or sodium concentration could modulate both expression and activity of the Na+-NQR complex.

  • Nutrient availability: Carbon source availability may influence respiratory chain composition, including nqrE expression.

Experimental approaches to investigate these regulatory mechanisms include:

  • Reporter gene fusions to the nqrE promoter

  • DNA-protein interaction studies to identify transcription factors

  • Chromatin immunoprecipitation to map regulatory protein binding sites

  • Growth under varying environmental conditions with monitoring of nqrE expression levels

The identification of iron-dependent regulation for other N. gonorrhoeae proteins provides a methodological framework for similar studies with nqrE .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.