Recombinant Neisseria gonorrhoeae NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; NGK_2143; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Neisseria gonorrhoeae (strain NCCP11945)
Target Names
nuoK
Target Protein Sequence
MITLTHYLVLGALLFGISAMGIFMNRKNVLVLLMSIELMLLAVNFNFIAFSQHLGDTAGQ IFVFFVLTVAAAESAIGLAIMVLVYRNRQTINVADLDELKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving redox energy in a proton gradient.
Database Links

KEGG: ngk:NGK_2143

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K in Neisseria gonorrhoeae metabolism?

NADH-quinone oxidoreductase (also known as Complex I) is a crucial component of the electron transport chain in N. gonorrhoeae. The subunit K (nuoK) likely functions as a membrane-embedded component that contributes to proton translocation across the bacterial membrane, essential for energy generation through oxidative phosphorylation. Similar to other bacterial pathogens, this complex would be critical for N. gonorrhoeae survival, particularly under oxygen-limited conditions that may be encountered during infection. The bacterium's ability to adapt to various microenvironments during infection makes this energy-generating component particularly significant in pathogenesis.

How conserved is the nuoK gene across Neisseria species and clinical isolates?

While specific data on nuoK conservation is not directly available in the search results, research approaches can be inferred from studies of other N. gonorrhoeae proteins. For example, the N. gonorrhoeae adhesin complex protein (Ng-ACP) was found to be highly conserved across 50 gonococcal strains . A similar approach could be used for nuoK, examining sequence conservation across clinical isolates and comparing it with homologs in other Neisseria species.

To study nuoK conservation, researchers should:

  • Perform in silico analysis using databases like PubMLST (https://pubmlst.org/neisseria/)

  • Conduct PCR amplification and sequencing of the nuoK gene from diverse clinical isolates

  • Use Western blotting with anti-nuoK antibodies to confirm protein expression across strains

  • Analyze whether any identified sequence variations correlate with clinical parameters or antibiotic resistance profiles

What are the recommended methods for producing recombinant N. gonorrhoeae nuoK protein?

For successful production of recombinant nuoK protein, researchers should consider the following methodological approach:

  • Gene cloning: Amplify the nuoK gene from N. gonorrhoeae genomic DNA (strain FA1090 is commonly used as a reference strain ) using primers designed from the published genome sequence.

  • Expression vector selection: Choose an expression system suitable for membrane proteins, such as pET vectors with appropriate fusion tags (His-tag or GST) to facilitate purification.

  • Expression conditions: Test multiple expression conditions in E. coli host strains specifically designed for membrane protein expression (e.g., C41(DE3) or C43(DE3)).

  • Protein extraction: Use specialized detergents for membrane protein solubilization (e.g., n-dodecyl β-D-maltoside or CHAPS).

  • Purification strategy: Implement a two-step purification process using affinity chromatography followed by size exclusion chromatography.

  • Verification: Confirm protein identity using Western blotting and mass spectrometry, and verify proper folding using circular dichroism spectroscopy.

This approach draws parallels to methods used for recombinant production of other N. gonorrhoeae proteins, such as the adhesin complex protein that was successfully expressed and characterized structurally .

How does nuoK gene expression change during different stages of N. gonorrhoeae infection and biofilm formation?

Understanding nuoK expression patterns during infection is critical for elucidating its role in pathogenesis. Based on methodologies used to study other N. gonorrhoeae genes, researchers should:

  • Design qRT-PCR primers specific to nuoK to quantify expression under various conditions.

  • Compare gene expression between:

    • Planktonic vs. biofilm growth phases

    • Aerobic vs. microaerobic conditions

    • Early vs. late infection models

    • Different pH and nutrient conditions mimicking various infection sites

  • Create reporter gene constructs (e.g., nuoK promoter-GFP fusions) to visualize expression in real-time during infection.

  • Perform RNA-seq analysis comparing global gene expression patterns between wild-type and nuoK knockout strains.

  • Examine co-expression patterns with other respiratory chain components.

Similar approaches revealed that disruption of the ngoAXmod gene in N. gonorrhoeae led to deregulation of 121 genes (5.61% of the total gene pool) under standard growth conditions , suggesting extensive metabolic adaptations. A comparable pattern might be expected for nuoK disruption.

What is the impact of nuoK gene knockout on N. gonorrhoeae virulence and host cell interactions?

To determine the role of nuoK in N. gonorrhoeae pathogenesis, researchers should employ methodologies similar to those used for other N. gonorrhoeae genes:

  • Create a nuoK knockout strain using established genetic manipulation techniques in N. gonorrhoeae:

    • Construct a plasmid containing the nuoK gene disrupted by an antibiotic resistance cassette

    • Linearize the vector and transform N. gonorrhoeae

    • Select transformants on antibiotic-containing media

    • Verify disruption by PCR, sequencing, and Southern blot

  • Create a complementation strain by reintroducing the wild-type nuoK gene at a neutral chromosomal site.

  • Compare the following parameters between wild-type, knockout, and complemented strains:

    • Growth rates in different media and oxygen conditions

    • Biofilm formation capacity

    • Adhesion to and invasion of human epithelial cells

    • Survival within host cells

    • Resistance to oxidative stress and antimicrobial peptides

Research on the NgoAX methyltransferase knockout showed significant differences in growth patterns, with the mutant growing more rapidly than wild-type under standard conditions . The NgoAX knockout also demonstrated altered biofilm structure and host cell interactions, with lower adhesion but higher invasion indices compared to wild-type . Similar multifaceted analysis would be valuable for understanding nuoK's role.

How does the structure of nuoK contribute to its function in the NADH-quinone oxidoreductase complex?

To elucidate the structure-function relationship of nuoK:

  • Perform X-ray crystallography of purified recombinant nuoK, similar to the approach used for determining the structure of N. gonorrhoeae adhesin complex protein at 1.65Å resolution .

  • Use cryo-electron microscopy to visualize the entire NADH-quinone oxidoreductase complex.

  • Identify conserved residues through multiple sequence alignment and target them for site-directed mutagenesis.

  • Measure enzymatic activity of the complex with wild-type vs. mutated nuoK variants.

  • Employ molecular dynamics simulations to predict:

    • Protein-lipid interactions

    • Proton translocation pathways

    • Conformational changes during catalysis

  • Compare structural features with homologous proteins from other bacteria to identify unique characteristics that might be exploited for targeted inhibitor development.

What are the most effective methods for studying nuoK protein interactions with other subunits of the NADH-quinone oxidoreductase complex?

To investigate protein-protein interactions involving nuoK:

  • Co-immunoprecipitation (Co-IP) assays:

    • Generate specific antibodies against nuoK or use tagged recombinant versions

    • Pull down nuoK and identify interacting partners by mass spectrometry

  • Bacterial two-hybrid system:

    • Adapt the bacterial two-hybrid system for membrane proteins

    • Screen for interactions between nuoK and other subunits

  • Cross-linking mass spectrometry:

    • Use chemical cross-linkers to capture transient interactions

    • Identify cross-linked peptides by tandem mass spectrometry

  • FRET (Förster Resonance Energy Transfer) analysis:

    • Create fluorescent protein fusions to visualize interactions in live cells

    • Measure energy transfer as an indicator of protein proximity

  • Complementary genetic approaches:

    • Perform suppressor mutation analysis

    • Study synthetic lethal interactions

These methodologies would provide complementary data on how nuoK interacts within the complex and potentially with other cellular components.

How can researchers effectively measure the functional activity of recombinant nuoK in vitro?

Assessing the functional activity of recombinant nuoK requires specialized approaches due to its role as part of a multi-subunit membrane complex:

  • Reconstitution into proteoliposomes:

    • Incorporate purified nuoK into artificial membrane vesicles

    • Measure proton pumping using pH-sensitive fluorescent dyes

  • Enzyme activity assays:

    • Measure NADH oxidation rates spectrophotometrically

    • Track electron transfer using artificial electron acceptors

  • Membrane potential measurements:

    • Use voltage-sensitive dyes to monitor membrane potential changes

    • Compare activity between liposomes containing wild-type vs. mutant nuoK

  • Proton translocation assays:

    • Monitor proton movement across membranes using pH indicators

    • Calculate H⁺/e⁻ ratios to determine coupling efficiency

  • Inhibition studies:

    • Test known Complex I inhibitors against recombinant nuoK

    • Screen for novel inhibitors that specifically target gonococcal nuoK

MethodMeasurementTechnical RequirementsAdvantagesLimitations
Proteoliposome reconstitutionProton pumpingPurified protein, lipids, pH indicatorsDirect functional measurementTechnically challenging
NADH oxidationDecrease in A₃₄₀Spectrophotometer, purified enzymeQuantitative, reproducibleIndirect measure of nuoK function
Membrane potentialFluorescence changesVoltage-sensitive dyes, fluorometerSensitive detectionBackground interference
Proton translocationpH changespH electrode or indicatorsDirect measure of functionRequires tight vesicles
Inhibition assaysIC₅₀ valuesCompound libraries, activity assaysTherapeutic potentialMay not be nuoK-specific

What are the recommended cell culture models for studying nuoK's role in host-pathogen interactions?

To investigate how nuoK contributes to N. gonorrhoeae pathogenesis in human infections:

  • Primary cell culture models:

    • Human cervical, urethral, or rectal epithelial cells

    • Polarized epithelial cell systems to mimic mucosal surfaces

    • Co-culture systems with immune cells (neutrophils, macrophages)

  • Cell line models and conditions:

    • Hec-1-B epithelial cells (as used in studies of NgoAX )

    • T84 or Caco-2 cells for polarized epithelium

    • Growth under microaerobic conditions to mimic infection sites

  • Infection parameters to measure:

    • Bacterial adhesion index

    • Invasion index

    • Intracellular survival

    • Host inflammatory responses (cytokine production)

    • Effects on epithelial barrier integrity

  • Advanced tissue models:

    • 3D organoid cultures derived from primary human tissues

    • Organ-on-chip models incorporating flow and multiple cell types

    • Ex vivo tissue explant models

The research on NgoAX demonstrated significant differences in host cell interactions between wild-type and mutant strains, with adhesion indices of 2.15 and 0.672, respectively, and invasion indices of 4.67×10⁴ and 3.38×10⁵, respectively . Similar quantitative approaches should be applied when studying nuoK's impact on host-pathogen interactions.

How should researchers analyze transcriptomic data to identify metabolic pathways affected by nuoK mutations?

When analyzing global transcriptomic changes resulting from nuoK mutations:

  • Experimental design considerations:

    • Include appropriate biological replicates (minimum n=3)

    • Compare wild-type, nuoK knockout, and complemented strains

    • Examine multiple growth conditions relevant to infection

  • Data analysis pipeline:

    • Quality control and normalization of RNA-seq data

    • Differential expression analysis using DESeq2 or similar tools

    • Pathway enrichment analysis using KEGG, GO terms, or COG categories

    • Network analysis to identify co-regulated gene clusters

  • Validation approaches:

    • Confirm key findings with qRT-PCR

    • Correlate transcriptomic changes with proteomic data

    • Verify metabolic predictions with biochemical assays

Studies of the NgoAX methyltransferase knockout revealed deregulation of 121 genes when using a twofold cutoff or 249 genes when using a 1.5-fold cutoff . Analysis by COG categories revealed that affected genes encoded proteins involved in cell metabolism, DNA replication and repair, and cellular processes including cell wall/envelope biogenesis . Similar comprehensive categorization would be valuable for understanding the systemic effects of nuoK disruption.

What statistical approaches are most appropriate for analyzing nuoK structure-function relationships?

To robustly analyze structure-function data for nuoK:

  • Statistical methods for sequence analysis:

    • Multiple sequence alignment significance testing

    • Conservation scoring with Jensen-Shannon divergence

    • Coevolution analysis to identify functionally linked residues

  • Structure-based statistical approaches:

    • RMSD calculations for structural comparisons

    • B-factor analysis for flexibility assessment

    • Molecular dynamics trajectory analysis

  • Experimental data analysis:

    • ANOVA with post-hoc tests for comparing multiple variants

    • Non-parametric tests when data doesn't meet normality assumptions

    • Mixed-effects models for experiments with multiple variables

  • Reporting standards:

    • Always include p-values with appropriate corrections for multiple testing

    • Report effect sizes along with statistical significance

    • Provide confidence intervals for key measurements

For research involving gonococcal proteins, statistical significance has typically been reported at p<0.05, as seen in studies comparing growth rates and biofilm formation between wild-type and mutant strains .

How might nuoK be targeted for potential therapeutic development against antibiotic-resistant N. gonorrhoeae?

With the emergence of multidrug-resistant N. gonorrhoeae strains, exploring nuoK as a therapeutic target represents an important research direction:

  • Rational drug design approaches:

    • Structure-based virtual screening against the nuoK binding site

    • Fragment-based drug discovery

    • Design of peptidomimetics that disrupt complex assembly

  • High-throughput screening strategies:

    • Develop cell-based assays suitable for screening compound libraries

    • Focus on compounds that selectively inhibit gonococcal growth

    • Screen for synergistic effects with existing antibiotics

  • Validation of target specificity:

    • Generate resistant mutants and characterize resistance mechanisms

    • Perform binding studies with putative inhibitors

    • Assess effects on human mitochondrial Complex I to ensure selectivity

  • Therapeutic potential assessment:

    • Test efficacy in cellular and animal infection models

    • Evaluate pharmacokinetic properties and toxicity

    • Assess resistance development frequency

The World Health Organization has listed N. gonorrhoeae as a high-priority pathogen for research and development of new control measures , emphasizing the importance of exploring novel targets like nuoK for therapeutic intervention.

What is the relationship between nuoK function and N. gonorrhoeae biofilm formation?

Understanding how energy metabolism through nuoK affects biofilm formation:

  • Comparative biofilm analysis:

    • Quantify biofilm formation by wild-type vs. nuoK mutant strains using crystal violet staining

    • Examine biofilm structure using field emission scanning electron microscopy (FE SEM)

    • Analyze extracellular matrix composition and production

  • Energy dynamics in biofilms:

    • Measure ATP levels within biofilm structures

    • Use redox-sensitive probes to map metabolic activity zones

    • Monitor oxygen gradients within biofilms

  • Gene expression in biofilms:

    • Perform transcriptomic analysis of wild-type vs. nuoK mutant biofilms

    • Identify differentially expressed adhesins and matrix components

    • Compare with planktonic growth expression patterns

Studies on the NgoAX knockout demonstrated altered biofilm formation, with the mutant forming slightly larger biofilm biomass per cell and producing more relaxed, dispersed, and thicker biofilms than the wild-type strain . Similar comprehensive analysis of biofilm characteristics should be applied when studying nuoK's impact.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.