Recombinant Neisseria gonorrhoeae Probable intracellular septation protein A (NGO1659)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; NGO1659; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Target Names
NGO1659
Target Protein Sequence
MKFVSDLLSVILFFATYTVTKNMIAAAAVALVAGVVQAAFLYWKHKRLDTMQWVGLVLIV VFGGATIVLGDSRFIMWKPTVLFWCGALFLLGSHLAGKNGLKASIGREIQLPDAVWGKLT YMWVGFLIFMGIANWFVFTRFEAQWVNYKMFGSTALMLFFFIIQGIYLSTYLKKED
Uniprot No.

Target Background

Function
This protein plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links

KEGG: ngo:NGO1659

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NGO1659 and what is its functional significance in Neisseria gonorrhoeae?

NGO1659 is classified as a probable intracellular septation protein A in Neisseria gonorrhoeae. The full-length protein consists of 176 amino acids and is believed to play a role in bacterial cell division processes . While the precise functional mechanisms remain under investigation, septation proteins typically participate in the formation of the septum during bacterial cell division.

To determine the functional significance of NGO1659, researchers should consider employing gene knockdown or knockout studies similar to those used for FLCN in host cells, where shRNA constructs were generated to downregulate target gene expression . Functional analysis would involve comparing wild-type and NGO1659-deficient strains for growth rate, cell morphology, and division patterns. Additionally, complementation studies with recombinant NGO1659 would confirm whether observed phenotypes are specifically attributable to this protein.

What approaches should be used for structural characterization of NGO1659?

For comprehensive structural characterization of NGO1659, researchers should employ multiple complementary techniques:

  • X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure.

  • Circular dichroism spectroscopy to analyze secondary structure elements.

  • Mass spectrometry for accurate molecular weight determination and post-translational modifications identification.

  • Computational prediction methods to identify functional domains and structural motifs.

  • Fluorescence spectroscopy to examine conformational dynamics.

When conducting structural studies, it's critical to ensure high protein purity and appropriate buffer conditions. The recombinant His-tagged version of NGO1659 available for research (full length 1-176) provides a valuable starting point for structural characterization .

How does NGO1659 contribute to bacterial pathogenesis?

The role of NGO1659 in N. gonorrhoeae pathogenesis should be investigated through a multifaceted approach:

  • Infection assays using cell lines such as HeLa2000, comparing wild-type and NGO1659-deficient strains. Similar methodologies to those used in FLCN studies could be adapted, where gentamicin protection assays were employed to determine bacterial adherence and internalization .

  • Analyze whether NGO1659 affects key virulence mechanisms, including:

    • Bacterial adherence to host cells

    • Intracellular survival

    • Immune response evasion

    • Trans-epithelial migration

  • Study the interaction between NGO1659 and host factors, as research has shown that serum factors like fetal bovine serum (FBS) can enhance bacterial adherence and uptake during infection studies .

Current research indicates that intracellular bacterial proteins can significantly influence infection processes, and proteins involved in basic cellular functions like septation may have secondary roles in pathogenesis.

What are the optimal conditions for expressing recombinant NGO1659?

For optimal expression of recombinant NGO1659, consider the following methodological approach:

  • Expression system: Use E. coli BL21(DE3) with the pET28a vector system for high-level expression of His-tagged NGO1659 .

  • Optimization parameters:

    • Induction temperature: Test a range (17°C, 27°C, and 37°C) to determine optimal conditions

    • IPTG concentration: Begin with 0.8 mM and adjust as needed

    • Induction time: Evaluate different durations (4, 6, and 8 hours)

    • Culture conditions: Consider both standard gravity (NG) and simulated microgravity (SMG) conditions

  • SMG cultivation considerations:

    • Use a high-aspect rotating-wall vessel (HARV) with different rotary speeds (10, 15, 20, and 30 rpm)

    • Monitor growth by measuring OD600 periodically

    • Perform triplicate independent experiments for statistical validity

Optimization experiments should systematically test each parameter while keeping others constant. For example, this table represents a potential experimental design for temperature optimization:

Temperature (°C)IPTG (mM)Induction Time (h)Rotary Speed (rpm)Protein Yield
170.8620To be determined
270.8620To be determined
370.8620To be determined

How can simulated microgravity enhance the production of recombinant NGO1659?

Simulated microgravity (SMG) has been shown to enhance recombinant protein production in E. coli expression systems. For NGO1659 expression, researchers should:

  • Implement SMG conditions using a high-aspect rotating-wall vessel (HARV) with horizontal rotation, compared to normal gravity (NG) conditions with vertical rotation .

  • Follow this methodological approach:

    • Culture cells in LB medium with appropriate antibiotics (e.g., 50 μg/ml kanamycin)

    • Pre-culture at 37°C for 4 hours before IPTG induction

    • Test different rotary speeds (10, 15, 20, and 30 rpm) to identify optimal conditions

    • Conduct parallel NG cultures as controls under identical conditions except for HARV orientation

  • Evaluation metrics:

    • Cell growth (OD600 measurements)

    • Protein yield (SDS-PAGE analysis of soluble fraction and inclusion bodies)

    • Protein activity assays

    • Plasmid copy number determination

Research has demonstrated that SMG cultivation can lead to higher productivity of recombinant proteins and increased plasmid copy number in E. coli . The mechanisms likely involve changes in ribosomal protein assembly and protein folding processes. For NGO1659, systematic optimization of SMG parameters could significantly improve production yields and potentially protein quality.

What cellular models are appropriate for studying NGO1659 function?

To effectively study NGO1659 function, several complementary cellular models should be considered:

  • Bacterial systems:

    • Isogenic N. gonorrhoeae strains (wild-type vs. NGO1659 knockout/knockdown)

    • Heterologous expression in laboratory E. coli strains for functional complementation studies

    • Related Neisseria species for comparative studies

  • Host cell infection models:

    • Epithelial cell lines, such as HeLa2000, which have been used successfully in N. gonorrhoeae infection studies

    • Cell lines with specifically modified gene expression (e.g., FLCN knockdown) to study interaction between bacterial and host factors

    • Primary human cell cultures for more physiologically relevant models

  • Experimental considerations:

    • Media composition significantly impacts infection efficiency; include or exclude fetal bovine serum (FBS) based on experimental goals

    • Generate stable shRNA-expressing cell lines for consistent knockdown effects

    • Use gentamicin protection assays to differentiate between adherent and intracellular bacteria

When designing cellular models for NGO1659 research, carefully consider which aspects of protein function you're investigating (septation, pathogenesis, protein-protein interactions) and select models that best represent those specific processes.

What techniques can be used to study protein-protein interactions involving NGO1659?

To comprehensively characterize protein-protein interactions involving NGO1659, employ multiple complementary approaches:

  • In vitro techniques:

    • Pull-down assays using His-tagged recombinant NGO1659

    • Surface plasmon resonance (SPR) for real-time interaction kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Cell-based methods:

    • Bacterial two-hybrid systems adapted for Neisseria

    • Co-immunoprecipitation from bacterial lysates

    • FRET/BRET assays for interactions in living cells

  • Computational approaches:

    • Protein-protein interaction prediction algorithms

    • Molecular docking simulations

    • Sequence-based interaction site prediction

When identifying potential interaction partners, focus on:

  • Other septation proteins

  • Cell division machinery components

  • Proteins involved in peptidoglycan synthesis

  • Host cell factors during infection

Data from these studies should be organized in interaction networks and validated using multiple independent techniques. This approach is particularly important as current publicly available information about NGO1659 interaction partners appears limited .

How can I analyze contradictory findings in NGO1659 research?

When faced with contradictory findings in NGO1659 research, implement a systematic approach to resolution:

  • Methodological reconciliation:

    • Compare experimental conditions in detail (strains, media, growth conditions)

    • Analyze differences in protein constructs (full-length vs. truncated, tag position)

    • Evaluate data collection and analysis methods

  • Contradiction analysis framework:

    • Categorize contradictions by type (direct negation, scalar differences, structural differences)

    • Distinguish between actual contradictions and apparent contradictions due to contextual differences

    • Consider whether contradictions arise from different aspects of a complex phenomenon

  • Resolution strategies:

    • Design experiments specifically to address contradictory findings

    • Develop unified models that accommodate seemingly contradictory results

    • Conduct meta-analyses of multiple studies to identify patterns

  • Document analysis:

    • Examine the precision of language in contradictory reports

    • Check for consistent use of terminology and definitions

    • Look for unstated assumptions that might explain discrepancies

Remember that contradictions in research often lead to deeper understanding of complex systems. A methodical approach to analyzing these contradictions can generate valuable new hypotheses about NGO1659 function.

How should I design experiments to investigate NGO1659's role in cellular septation?

To effectively investigate NGO1659's role in cellular septation, design a comprehensive experimental approach:

  • Genetic manipulation strategies:

    • Generate conditional knockdown/knockout strains using CRISPR-Cas9 or shRNA technologies

    • Create fluorescently tagged NGO1659 constructs for localization studies

    • Develop point mutations in key functional domains

  • Microscopy techniques:

    • Time-lapse fluorescence microscopy to monitor septation dynamics

    • Super-resolution microscopy for detailed localization

    • Transmission electron microscopy to visualize septum formation

  • Biochemical approaches:

    • In vitro septation assays with purified components

    • Analysis of peptidoglycan synthesis in the presence/absence of NGO1659

    • Enzymatic activity assays if catalytic function is suspected

  • Experimental design table:

Research QuestionExperimental ApproachControlsExpected Outcome if Hypothesis Correct
Does NGO1659 localize to the septation site?Fluorescence microscopy with tagged proteinNon-septation protein localizationNGO1659 concentrates at mid-cell during division
Is NGO1659 essential for septation?Growth of knockout strainWild-type growth curveGrowth defect or cell chaining phenotype
Does NGO1659 interact with known septation proteins?Co-immunoprecipitationNon-specific antibody pull-downCo-precipitation of septation machinery components
  • Data collection plan:

    • Quantitative metrics (growth rates, septum formation rates)

    • Qualitative assessment (cell morphology, division defects)

    • Statistical analysis approach (ANOVA, t-tests as appropriate)

What methodological approaches should be used to study NGO1659's role in N. gonorrhoeae infection?

To comprehensively investigate NGO1659's role in N. gonorrhoeae infection, implement this methodological framework:

  • Infection model preparation:

    • Select appropriate cell lines (e.g., HeLa2000) and primary cells

    • Consider generating host factor knockdown lines (e.g., FLCN, E-cadherin) to study interactions

    • Develop fluorescently labeled bacterial strains for visualization

  • Infection process analysis:

    • Assess adherence using antibody-based detection or direct microscopy

    • Quantify invasion and intracellular survival using gentamicin protection assays

    • Measure bacterial transcytosis through polarized cell monolayers

  • Host response evaluation:

    • Analyze cytokine/chemokine production using ELISAs or multiplex assays

    • Assess changes in host cell signaling pathways via Western blotting

    • Evaluate host gene expression changes using qPCR or RNA-seq

  • Experimental considerations:

    • Include appropriate controls (e.g., known invasion factors like Opa proteins)

    • Test both serum-containing and serum-free conditions, as FBS can significantly affect bacterial adherence and uptake

    • Perform experiments in triplicate with appropriate statistical analysis

  • Advanced molecular approaches:

    • RNA interference screening to identify host factors affecting NGO1659-mediated processes

    • CRISPR-Cas9-based genetic screens in both bacteria and host cells

    • Proteomics analysis of host-pathogen protein-protein interactions

This systematic approach will help identify whether NGO1659, despite being a septation protein, has additional roles in bacterial pathogenesis, similar to other bacterial proteins with dual functions.

What statistical approaches are most appropriate for analyzing NGO1659 experimental data?

For robust analysis of NGO1659 experimental data, implement these statistical approaches:

For specialized analyses, consider consulting with a biostatistician who has experience with microbiological data to ensure appropriate statistical methodologies.

Where can I find genomic and proteomic resources for NGO1659 research?

To access comprehensive resources for NGO1659 research, utilize these databases and platforms:

  • Genomic resources:

    • NCBI GenBank for nucleotide sequences

    • Neisseria Base (https://pubmlst.org/neisseria/) for genomic data

    • Pathosystems Resource Integration Center (PATRIC) for comparative genomics

    • European Nucleotide Archive (ENA) for raw sequencing data

  • Protein resources:

    • UniProt for curated protein information

    • Protein Data Bank (PDB) for structural data

    • STRING database for predicted protein-protein interactions

    • Creative BioMart for recombinant protein acquisition

  • Functional annotation tools:

    • KEGG for pathway analysis

    • Gene Ontology (GO) for functional classification

    • InterPro for domain prediction

    • SignalP for signal peptide prediction

  • Literature resources:

    • PubMed for peer-reviewed publications

    • bioRxiv and medRxiv for preprints

    • Google Scholar for broader academic coverage

  • Research collaboration platforms:

    • ResearchGate for connecting with NGO1659 researchers

    • Addgene for plasmid sharing

    • BEI Resources for bacterial strain repositories

When using these resources, cross-reference information across multiple databases to ensure accuracy, as information about specialized proteins like NGO1659 may be limited or updated at different rates across platforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.