Recombinant Neisseria gonorrhoeae Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Neisseria gonorrhoeae and CrcB Protein

Neisseria gonorrhoeae is a Gram-negative bacterium responsible for the sexually transmitted infection gonorrhea. This pathogen can infect the eyes, throat, and genitals, with both men and women potentially developing asymptomatic infections that facilitate undetected transmission . The bacterium possesses remarkable capabilities to evade host immune surveillance through antigenic variation, which has significantly hampered vaccine development efforts . Among the various proteins expressed by N. gonorrhoeae, the CrcB protein has emerged as a subject of interest due to its potential role in bacterial survival mechanisms.

The CrcB protein homolog in N. gonorrhoeae represents a membrane protein that belongs to a superfamily predominantly composed of transporters . Initially, crcB genes were implicated in chromosome condensation and camphor resistance in bacterial species, but recent research has expanded our understanding of their functions . Evidence from studies in other bacterial species suggests that CrcB proteins function primarily as fluoride transporters, playing a critical role in reducing cellular concentrations of this potentially toxic anion .

Historical Context and Discovery

The identification of CrcB as a protein family occurred through comparative genomic analyses across various bacterial species. While the search results do not specifically detail the discovery history of the N. gonorrhoeae CrcB homolog, studies in related bacteria have established the importance of this protein family in ion transport mechanisms. The recombinant form of this protein, particularly the amino acid sequence 1-119 from strain NCCP11945, has been developed to facilitate research into its structure and function .

Protein Features and Domains

CrcB proteins are characterized as membrane proteins with multiple transmembrane domains that facilitate their function as transporters . The specific structural features that enable fluoride recognition and transport remain an area requiring further investigation in N. gonorrhoeae. Based on homology with related proteins, the CrcB protein likely adopts a conformation that creates a selective channel or pore structure within the bacterial membrane.

Sequence Conservation

While the search results do not provide specific data on sequence conservation of N. gonorrhoeae CrcB, the functionality of this protein across diverse bacterial species suggests conservation of critical domains involved in fluoride transport. This conservation would be particularly important for regions involved in anion recognition and channel formation.

Table 1: Basic Properties of Recombinant N. gonorrhoeae CrcB Protein

PropertyDescription
NameRecombinant Neisseria Gonorrhoeae crcB Protein (aa 1-119)
StrainNCCP11945
Amino Acid Range1-119
Predicted FunctionMembrane protein involved in fluoride transport
Cellular LocalizationMembrane-associated
Expression SourcesE. coli, Yeast, Baculovirus, or Mammalian Cell

Functional Role of CrcB in Bacterial Physiology

Research on CrcB homologs in various bacterial species has significantly expanded our understanding of this protein's functional role, particularly in relation to fluoride resistance mechanisms.

Fluoride Transport Function

Studies in Escherichia coli have demonstrated that CrcB proteins function as fluoride transporters critical for reducing intracellular concentrations of this anion . Knockout experiments in E. coli have shown that deletion of the crcB gene renders bacteria significantly more sensitive to fluoride, with growth inhibition occurring at much lower fluoride concentrations compared to wild-type strains . While direct evidence for this function in N. gonorrhoeae CrcB is not explicitly stated in the search results, the high conservation of function across bacterial species strongly suggests a similar role.

Relationship to Fluoride Riboswitches

An intriguing aspect of CrcB biology is its relationship with fluoride-responsive riboswitches. These RNA structures can detect fluoride ions and subsequently regulate the expression of genes encoding fluoride resistance proteins, including CrcB . This regulatory mechanism suggests that bacterial exposure to fluoride triggers a coordinated response that includes upregulation of CrcB production to mitigate fluoride toxicity. The presence of such sophisticated regulatory systems underscores the evolutionary importance of fluoride resistance for bacterial survival.

Table 2: Evidence for CrcB Function in Fluoride Resistance

Experimental SystemKey FindingImplication
E. coli wild-typeGrowth inhibition at ~200 mM NaF Baseline fluoride resistance
E. coli crcB knockoutGrowth inhibition at >1 mM NaF CrcB critical for fluoride resistance
Fluoride riboswitch expressionActivation of reporter gene expression by fluoride Coordinated regulation of fluoride resistance
Cross-species complementationP. syringae eriCF rescues E. coli crcB knockout Functional equivalence across species

Expression Systems and Production Methods

The recombinant N. gonorrhoeae CrcB protein can be produced using several expression systems, providing flexibility for different research applications.

Bacterial Expression Systems

E. coli represents a common and efficient system for the expression of recombinant N. gonorrhoeae CrcB protein . This system offers advantages including rapid growth, high protein yields, and well-established protocols for induction and purification.

Eukaryotic Expression Systems

Alternative expression platforms include yeast, baculovirus, and mammalian cell systems . These eukaryotic systems may provide advantages for certain applications, particularly when post-translational modifications or specific folding conditions are required for proper protein function or immunogenicity.

Table 3: Expression Systems for Recombinant N. gonorrhoeae CrcB Production

Expression SystemAdvantagesPotential Limitations
E. coliHigh yield, cost-effective, rapid productionMay lack certain post-translational modifications
YeastEukaryotic processing, secretion possibleLonger production time, glycosylation patterns differ from mammals
BaculovirusComplex protein folding, high expressionMore technically demanding, higher cost
Mammalian CellNative-like folding and modificationsHighest cost, lower yields, longer production time

Potential Applications in Research and Therapeutics

The recombinant N. gonorrhoeae CrcB protein offers several potential applications in both research and therapeutic development.

Antimicrobial Target Development

Understanding the role of CrcB in fluoride resistance and bacterial survival could inform the development of novel antimicrobial strategies. If CrcB function is essential for N. gonorrhoeae survival under certain conditions, inhibitors targeting this protein could potentially serve as effective antimicrobials. This approach may be particularly relevant given the increasing prevalence of antibiotic-resistant N. gonorrhoeae strains.

Comparison with Other N. gonorrhoeae Membrane Proteins

To contextualize the significance of CrcB within N. gonorrhoeae biology, it is instructive to compare it with other well-characterized membrane proteins from this pathogen.

CrcB and Porin Proteins

The major outer membrane porin (PorB) of N. gonorrhoeae has been extensively studied for its multiple roles during infection . Unlike CrcB, which appears primarily involved in ion homeostasis, PorB contributes directly to pathogenesis through interactions with host immune components, including complement regulatory factors such as C4b-binding protein and factor H . These interactions help N. gonorrhoeae evade complement-mediated killing, highlighting the diverse functions of membrane proteins in this pathogen.

CrcB and Adhesin Complex Protein

Another significant membrane-associated protein in N. gonorrhoeae is the adhesin complex protein (Ng-ACP), which has been shown to be highly conserved across gonococcal strains . Recombinant Ng-ACP has demonstrated potential as a vaccine candidate, inducing antibodies in mice that effectively killed bacteria in vitro . The structural conservation of Ng-ACP has been characterized through X-ray crystallography, revealing similarities to proteins that inhibit human lysozyme . This level of structural and functional characterization represents a target for similar studies on CrcB.

Table 4: Comparison of N. gonorrhoeae Membrane Proteins

ProteinPrimary FunctionRole in PathogenesisVaccine Potential
CrcBFluoride transport (inferred) Not directly establishedUnder investigation
PorBNutrient transport, membrane pore Complement evasion, inhibition of immune cell functions Variable due to allelic diversity
Ng-ACPAdhesion Bacterial attachment, potential lysozyme inhibition Demonstrated antibody induction in mice

Current Research Challenges and Future Directions

Despite the progress in understanding CrcB proteins, several challenges and knowledge gaps remain in the study of N. gonorrhoeae CrcB specifically.

Functional Validation

While evidence from other bacterial species strongly suggests a role for CrcB in fluoride transport and resistance, direct experimental validation of this function in N. gonorrhoeae would strengthen our understanding of its physiological role. Knockout studies, similar to those performed in E. coli , could elucidate the importance of CrcB for gonococcal survival under various conditions.

Immunological Studies

To assess the potential of recombinant N. gonorrhoeae CrcB as a vaccine component, comprehensive immunological studies are needed to determine its antigenicity, conservation across strains, and ability to induce protective immune responses. Initial studies may focus on whether antibodies against recombinant CrcB demonstrate bactericidal activity against diverse N. gonorrhoeae isolates.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; NGK_0952; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Neisseria gonorrhoeae (strain NCCP11945)
Target Names
crcB
Target Protein Sequence
MLSNILPLSIGAIFGTTARWLLNLAVPASLSPATGNLFANWTGALLIGIFAETVSHPQWK LLLITGFFGSLTTLSGFSLETVTLLQSNRPASALANIFLHTAGSLLLTWLGLKIGTAVK
Uniprot No.

Target Background

Function
Essential for reducing fluoride concentration in the cell, thereby mitigating its toxicity.
Database Links

KEGG: ngk:NGK_0952

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Neisseria gonorrhoeae CrcB protein homolog?

The CrcB protein homolog in Neisseria gonorrhoeae is a membrane protein that shares sequence similarity with CrcB proteins found in other bacterial species. Based on studies in related organisms, it likely functions as a fluoride ion channel or transporter involved in fluoride resistance . The protein is approximately 12-14 kDa in size, with the recombinant form containing amino acids 1-119 in the NCCP11945 strain being most commonly studied . The protein's structure consists of membrane-spanning domains that form a channel within the bacterial membrane, allowing for ion transport regulation.

How does CrcB protein relate to N. gonorrhoeae pathogenesis?

While the direct role of CrcB in N. gonorrhoeae pathogenesis remains under investigation, it likely contributes to the bacterium's ability to survive environmental stresses during infection. N. gonorrhoeae is known to employ various mechanisms for immune evasion, including antigenic variation and resistance to serum killing . Like other membrane proteins such as porins (Por) which interact with host complement inhibitors like C4b-binding protein (C4BP) , CrcB may play a role in maintaining membrane integrity under stress conditions faced during infection, including exposure to antimicrobial compounds produced by the host.

What is the genetic organization of the crcB gene in N. gonorrhoeae?

The crcB gene in N. gonorrhoeae is part of the core genome, unlike some other genes involved in antigenic variation that are found on transposable elements or plasmids . Comparative genomic analysis indicates that crcB is relatively conserved across Neisseria species, though detailed analyses of sequence variations across clinical isolates are still emerging. The gene appears to have evolved as part of a bacterial defense mechanism against toxic ions, particularly fluoride, which is consistent with its purported function as an ion channel or transporter .

What expression systems are most effective for producing recombinant N. gonorrhoeae CrcB protein?

Recombinant N. gonorrhoeae CrcB protein can be expressed using several systems, with E. coli being the most commonly employed for initial characterization . When expressing membrane proteins like CrcB, selection of appropriate expression vectors containing solubility tags (such as MBP, GST, or SUMO) can improve protein yield and solubility. For higher-quality protein preparation needed for structural or functional studies, researchers may employ yeast, baculovirus, or mammalian cell expression systems . The choice depends on research goals:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapidMay have improper folding for membrane proteinsInitial characterization, antibody production
YeastBetter membrane protein folding, post-translational modificationsLower yield than E. coliFunctional studies
BaculovirusExcellent for complex eukaryotic proteinsTime-consuming, technically demandingStructural studies
Mammalian cellsMost native-like post-translational modificationsExpensive, lowest yieldInteraction studies with host proteins

What purification strategies yield the highest purity and activity for recombinant CrcB protein?

Purification of recombinant CrcB protein typically employs a multi-step approach due to its membrane-associated nature. After expression, cells are lysed and membrane fractions isolated through differential centrifugation. The protein can then be solubilized using detergents like n-dodecyl-β-D-maltoside (DDM) or 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS). A typical purification workflow involves:

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for final polishing

Researchers should monitor protein purity through SDS-PAGE and Western blotting . Protein activity can be assessed through fluoride ion transport assays, which measure the protein's ability to transport fluoride ions across membranes.

How can researchers develop reliable antibodies against CrcB protein?

Development of antibodies against CrcB protein follows standard immunization protocols, but requires special consideration due to the membrane-associated nature of the protein. A successful strategy involves:

  • Immunizing animals (typically mice or rabbits) with highly purified recombinant CrcB protein

  • Using appropriate adjuvants to enhance immunogenicity - studies with other N. gonorrhoeae proteins have employed Freund's adjuvant, aluminum hydroxide, or more modern adjuvants

  • Evaluating antibody specificity through Western blotting against both recombinant protein and native expression in N. gonorrhoeae

  • Testing cross-reactivity against CrcB homologs from other Neisseria species to determine specificity

Similar approaches have been successful for other N. gonorrhoeae proteins such as the adhesin complex protein (Ng-ACP), generating antibodies with high specificity and bactericidal activity .

What methods are most effective for studying the ion channel functions of CrcB protein?

The ion channel activity of CrcB protein can be studied using several complementary approaches:

  • Fluoride ion efflux assays: Measuring the transport of fluoride ions using fluoride-specific electrodes or fluorescent indicators in reconstituted proteoliposomes containing purified CrcB

  • Growth inhibition assays: Comparing growth of wild-type and crcB-deletion mutants in the presence of various concentrations of fluoride to assess the protein's role in resistance

  • Electrophysiological studies: Using patch-clamp techniques with reconstituted CrcB channels in artificial membranes to directly measure channel conductance and ion selectivity

  • Fluorescence-based transport assays: Utilizing fluorescent dyes sensitive to ion concentration to visualize transport in real-time

These functional characterization methods provide insights into the biophysical properties of the channel and its selectivity for fluoride over other ions.

How can genetic manipulation techniques be applied to study CrcB function in N. gonorrhoeae?

Genetic manipulation of crcB in N. gonorrhoeae can be achieved through several approaches:

  • Gene deletion: Creating knockout mutants through homologous recombination, similar to techniques used for other N. gonorrhoeae genes like Rmp . This involves replacing the crcB gene with an antibiotic resistance marker (such as kanamycin resistance cassette) flanked by homologous regions.

  • Complementation studies: Reintroducing wild-type or mutant crcB genes to deletion strains to confirm phenotypes and study structure-function relationships.

  • Site-directed mutagenesis: Creating point mutations in conserved residues to identify amino acids critical for channel function or protein stability.

  • Reporter fusions: Creating transcriptional or translational fusions to study expression patterns and localization.

The stability of genetic modifications should be verified through multiple generations of passage, similar to validation performed with other N. gonorrhoeae genetic constructs .

What phenotypic assays best characterize CrcB mutants in N. gonorrhoeae?

Phenotypic characterization of CrcB mutants should include:

Researchers should note that deletion of membrane proteins can sometimes have pleiotropic effects, requiring careful interpretation of phenotypic data.

How conserved is CrcB protein among different Neisseria species and strains?

Analysis of CrcB homologs across Neisseria species reveals a high degree of conservation, reflecting the protein's fundamental role in ion homeostasis. While specific sequence data for CrcB variation is limited in the provided search results, comparative approaches similar to those used for other N. gonorrhoeae proteins can be applied. Analysis of genomic databases such as PubMLST (https://pubmlst.org/neisseria/)[6] would likely show that:

  • Core functional domains are highly conserved between N. gonorrhoeae and N. meningitidis CrcB homologs

  • Variation is more likely in exposed loop regions rather than transmembrane domains

  • Conservation patterns would reflect evolutionary pressure to maintain ion channel function

This conservation pattern differs from highly variable surface-exposed proteins like pili components that undergo antigenic variation but may be similar to other housekeeping proteins involved in basic cellular functions.

What bioinformatic approaches are most useful for analyzing CrcB protein evolution?

Several bioinformatic approaches can provide insights into CrcB protein evolution:

  • Multiple sequence alignment: Tools like Clustal Omega, MUSCLE, or T-Coffee to align CrcB sequences from diverse Neisseria species and strains

  • Phylogenetic analysis: Maximum likelihood or Bayesian methods to construct evolutionary trees showing relationships between CrcB variants

  • Selection pressure analysis: Calculating dN/dS ratios to identify regions under purifying or diversifying selection

  • Protein structure prediction: Using homology modeling based on crystal structures of related proteins to predict the impact of sequence variations

  • Coevolution analysis: Identifying potential functional partners by detecting genes that show correlated evolutionary patterns with crcB

These approaches can reveal how CrcB has evolved within the Neisseria genus and identify regions critical for function versus those with greater tolerance for variation.

How do structural differences in CrcB variants affect function across Neisseria species?

Structural analysis of CrcB variants can provide insights into functional differences. While no crystal structure of N. gonorrhoeae CrcB is reported in the search results, approaches similar to those used for other proteins like the Neisseria adhesin complex protein (ACP) can be applied:

  • Homology modeling: Creating structural models based on crystal structures of homologous proteins from other bacteria

  • Molecular dynamics simulations: Simulating ion transport through different CrcB variant channels to predict functional differences

  • Structure-guided mutagenesis: Targeting specific residues predicted to be involved in ion selectivity or gating

  • Electrophysiological comparison: Directly comparing channel properties of different CrcB variants in reconstituted systems

These approaches can reveal how subtle sequence differences between CrcB variants might affect fluoride selectivity, transport rates, or regulation across different Neisseria species.

What is the potential of CrcB as a vaccine candidate against N. gonorrhoeae?

The potential of CrcB as a vaccine candidate against N. gonorrhoeae must be evaluated in the context of several factors:

  • Conservation and expression: CrcB appears to be conserved across strains and consistently expressed, making it potentially advantageous compared to highly variable surface antigens .

  • Accessibility to antibodies: As a membrane protein, portions of CrcB may be surface-exposed and accessible to antibodies, though its predicted topology would need to be experimentally verified.

  • Immunogenicity: Studies would need to determine if CrcB can elicit strong antibody responses, similar to evaluations performed for other N. gonorrhoeae proteins like Rmp and ACP .

  • Bactericidal activity: The critical test would be whether anti-CrcB antibodies can facilitate complement-mediated killing or opsonophagocytosis of N. gonorrhoeae.

The challenges in developing gonococcal vaccines stem from the bacterium's ability to evade immune responses through antigenic variation . Any CrcB-based vaccine approach would need to address these challenges.

What immunization strategies would be most effective for testing CrcB-based vaccine candidates?

Testing CrcB-based vaccine candidates would require a systematic approach:

  • Antigen design: Recombinant full-length CrcB versus selected peptide epitopes predicted to be surface-exposed and immunogenic

  • Adjuvant selection: Testing multiple adjuvant formulations, as demonstrated in studies with other N. gonorrhoeae proteins where adjuvant choice significantly affected bactericidal activity

  • Immunization schedule: Optimizing prime-boost intervals and routes of administration (intramuscular, subcutaneous, or mucosal delivery)

  • Animal models: Initial testing in mice followed by validation in more relevant models that better recapitulate human infection

  • Readouts: Measuring antibody titers, bactericidal activity, and protection in challenge models

An important consideration is the risk of inducing blocking antibodies, as observed with anti-Rmp antibodies that blocked rather than promoted the antibacterial effects of protective antibodies .

How can researchers address the challenge of antigenic variation when developing CrcB-targeted vaccines?

Addressing antigenic variation challenges requires strategic approaches:

  • Conservation analysis: Identifying highly conserved epitopes within CrcB that are less likely to undergo variation

  • Multi-target formulations: Combining CrcB with other conserved antigens to create a multi-component vaccine that targets multiple bacterial structures simultaneously

  • Epitope masking: Designing immunogens that direct immune responses toward conserved regions while masking variable regions

  • Strain coverage assessment: Testing vaccine-induced antibodies against a diverse panel of clinical isolates to ensure broad protection

  • Monitoring escape mutations: Surveillance for potential escape mutations in vaccinated populations

Studies of other N. gonorrhoeae proteins have shown that deletion mutants, such as the Rmp deletion mutant, can induce antibodies with higher bactericidal activities, suggesting potential strategies for optimizing antigen presentation .

How does CrcB interact with other membrane proteins in N. gonorrhoeae?

Understanding CrcB interactions with other membrane proteins represents an important research frontier:

  • Protein-protein interaction studies: Co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling approaches can identify interaction partners.

  • Membrane proteomics: Blue native PAGE combined with mass spectrometry to identify stable membrane protein complexes containing CrcB.

  • Functional coupling analysis: Investigating whether CrcB function is coupled to proton gradients, ATP hydrolysis, or other energy-coupling mechanisms through the action of associated proteins.

  • Genetic interaction screens: Creating double mutants to identify synthetic lethal or synthetic sick interactions that suggest functional relationships.

These approaches could reveal whether CrcB functions independently or as part of larger membrane protein complexes involved in ion homeostasis or membrane integrity.

What is the role of CrcB in antimicrobial resistance mechanisms of N. gonorrhoeae?

The potential role of CrcB in antimicrobial resistance represents a critical research area:

Understanding these relationships could provide insights into both natural and acquired resistance mechanisms in N. gonorrhoeae, which is increasingly problematic given the emergence of multi-drug resistant strains.

How does CrcB contribute to N. gonorrhoeae survival in different host environments?

CrcB may play diverse roles in adaptation to host environments:

  • Transcriptional regulation: Analysis of crcB expression under conditions mimicking different host niches (urethral, cervical, pharyngeal, rectal).

  • pH adaptation: Investigating whether CrcB contributes to survival under the varying pH conditions encountered in different anatomical sites.

  • Nutritional immunity: Determining if CrcB plays a role in counteracting host-mediated metal limitation strategies.

  • Biofilm formation: Assessing whether CrcB affects the formation or stability of gonococcal biofilms, which contribute to persistent infection.

  • Intracellular survival: Evaluating the contribution of CrcB to survival within host cells, particularly in relation to phagosomal acidification.

These investigations would expand our understanding of how fundamental ion homeostasis mechanisms contribute to the remarkable adaptability of N. gonorrhoeae across diverse host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.