Recombinant Neisseria gonorrhoeae UPF0070 protein NGO0425 (NGO0425)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Neisseria gonorrhoeae UPF0070 protein NGO0425 (NGO0425) is a protein associated with the bacterium Neisseria gonorrhoeae, which causes the sexually transmitted infection gonorrhea . NGO0425 is annotated as a UPF0070 (protein of unknown function) protein .

Chemical Properties

As a recombinant protein, NGO0425 is produced using genetic engineering techniques . Key identifiers and properties include:

  • CAS Number: Not available

  • Chemical Name: Recombinant Neisseria gonorrhoeae UPF0070 protein NGO0425 (NGO0425)

  • Molecular Weight: Data unavailable

  • Molecular Formula: Data unavailable

Function

The precise function of NGO0425 is not fully understood, but it may mediate protein transfer from the SecYEG translocon to the periplasmic chaperone network via its periplasmic C-terminal region .

Role in Neisseria gonorrhoeae

Neisseria gonorrhoeae is a human-specific pathogen responsible for gonorrhea . Effective control measures, including vaccines, are needed to combat this bacterium . Studies suggest that other N. gonorrhoeae proteins, such as Ng-ACP, are potential vaccine candidates because they stimulate the production of bactericidal antibodies .

NGO2105 Autotransporter Protein

  • Another protein in N. gonorrhoeae, NGO2105, is an autotransporter protein involved in adherence to and invasion of human cervical epithelial cells .

  • NGO2105 exhibits serine protease activity, with serine 267 being crucial for autoproteolytic processing and secretion .

  • Deleting ngo2105 significantly reduces the adherence and invasion capabilities of N. gonorrhoeae .

  • Anti-NGO2105 antibodies can inhibit N. gonorrhoeae adhesion and colonization .

Oxydifficidin Sensitivity

  • N. gonorrhoeae is uniquely sensitive to the antibiotic oxydifficidin because it contains both DedA (involved in antibiotic uptake) and an oxydifficidin-sensitive RplL protein .

  • Mutations in rplL can confer resistance to oxydifficidin .

  • DedA is critical for oxydifficidin's activity, enhancing its uptake and reducing the bacterium's kill time .

Immunoproteomics

  • Immunoproteomic studies of patients with gonorrhea have identified several N. gonorrhoeae proteins that react with patient sera, indicating their potential role in the immune response .

  • Examples include PilC/PilC2, which is involved in pilus assembly and adherence, and NGO1092, a large uncharacterized outer membrane protein .

Ng-ACP Adhesin Complex Protein

  • Ng-ACP is a conserved protein expressed by N. gonorrhoeae strains, making it a potential vaccine candidate .

  • Recombinant Ng-ACP induces bactericidal antibodies in mice and prevents Ng-ACP from inhibiting human lysozyme activity .

  • The crystal structure of Ng-ACP has been determined, revealing structural homology with lysozyme inhibitors from other bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NGO0425; Ancillary SecYEG translocon subunit; ORF2; Periplasmic chaperone YfgM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Target Names
NGO0425
Target Protein Sequence
MAAHLEEQQELDNFKYFWKTTGKWLFALLILAALGYLGYTVYQNRAASQNQEAAAVLANI VEKAQNKAPQSEINAELSKLQQSYPHSISAAQATLMAAATEFDAQRYDVAEGHLKWVLSN QKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEADFAPLLMETKGDVYAAQEKSQEA LKNYGQALEKMPQDSVGRELLQMKLDSLK
Uniprot No.

Target Background

Function
This protein may facilitate protein transfer from the SecYEG translocon to the periplasmic chaperone network via its periplasmic C-terminal region.
Database Links

KEGG: ngo:NGO0425

Protein Families
UPF0070 family
Subcellular Location
Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.

Q&A

What is NGO0425 and why is it significant for Neisseria gonorrhoeae research?

NGO0425 is a UPF0070 family protein found in Neisseria gonorrhoeae that has been identified as a potential vaccine candidate through proteomic profiling. It was discovered as part of comprehensive proteomics studies examining the cell envelope (CE) fraction of N. gonorrhoeae reference strains. The significance of NGO0425 lies in its identification as one of the novel antigens through antigen mining decision tree protocols, alongside other proteins including NGO0282, NGO0439, NGO0778, NGO1251, NGO1688, NGO1889, NGO1911a, and NGO2105 . As a potential surface-exposed protein with consistent expression across clinical isolates, NGO0425 represents a promising target for vaccine development against gonorrhea, a critical need given the growing threat of multidrug-resistant isolates and the current lack of an effective vaccine .

How was NGO0425 initially identified in proteomic studies?

NGO0425 was identified through a sophisticated proteomic workflow employing subcellular fractionation combined with tandem mass spectrometry. Specifically, researchers cultured multiple N. gonorrhoeae strains (including the 2016 WHO reference panel) to mid-logarithmic growth phase, followed by careful subcellular fractionation to separate cell envelope (CE) and cytoplasmic (C) proteins. The protein identification utilized tandem mass tags (TMT) coupled to liquid chromatography and tandem mass spectrometry (TMT-LC-MS/MS), which allowed for sensitive peptide labeling and simultaneous analysis of multiple biological samples . This approach enabled the detection of NGO0425 in the cell envelope fraction across examined strains, highlighting it as a consistently expressed protein with potential surface exposure . The identification was further validated through bioinformatic analyses for signal peptides and transmembrane motifs using specialized software including SignalP 4.1, LipoP 1.0, and TMHMM 2.0 .

What is the predicted subcellular localization of NGO0425 and how does this influence its potential applications?

Bioinformatic analyses using multiple subcellular localization prediction tools, including PSORTb 3.0.2, SOSUIGramN, and CELLO with a majority-voting strategy, have helped determine the likely cellular location of NGO0425 . The protein was identified in the cell envelope fraction, suggesting it may be associated with the bacterial surface or membrane structures. Further analysis for signal peptides and transmembrane motifs using SignalP 4.1, LipoP 1.0, and TMHMM 2.0 provided additional insights into its potential surface exposure .

The predicted localization significantly influences potential applications because surface-exposed proteins are accessible to antibodies and can elicit protective immune responses, making them prime candidates for vaccine development. If NGO0425 is indeed surface-exposed, it represents a promising target for generating protective antibodies against N. gonorrhoeae infection. Additionally, surface proteins often play crucial roles in pathogen-host interactions, suggesting that NGO0425 could also be investigated as a therapeutic target for novel antimicrobial approaches .

What are the optimal methods for recombinant expression and purification of NGO0425?

For recombinant expression of NGO0425, an E. coli-based expression system is generally recommended due to its high yield and relative simplicity. Based on proteomic studies of similar N. gonorrhoeae proteins, the following methodological approach is advised:

  • Gene cloning strategy: Amplify the NGO0425 coding sequence from genomic DNA of N. gonorrhoeae (preferably strain WHO F as a reference) using high-fidelity PCR. Design primers with appropriate restriction sites for directional cloning into an expression vector containing an affinity tag (6xHis or GST tags are commonly used) .

  • Expression vector selection: For optimal expression, pET-based vectors (such as pET28a) with T7 promoter systems often yield good results for bacterial proteins. Include a removable tag for downstream applications requiring tag-free protein .

  • Expression conditions: Transform the construct into E. coli BL21(DE3) or Rosetta(DE3) strains. For initial expression trials, test multiple conditions:

    • IPTG concentrations: 0.1 mM, 0.5 mM, and 1.0 mM

    • Temperature: 16°C, 25°C, and 37°C

    • Induction time: 4 hours vs. overnight

  • Purification protocol:

    • Lyse cells using a combination of lysozyme treatment and sonication in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and protease inhibitors

    • For His-tagged proteins, use immobilized metal affinity chromatography (IMAC) with nickel or cobalt resin

    • Further purify using size exclusion chromatography to ensure high purity

    • Verify purity using SDS-PAGE and Western blotting

  • Protein refolding: If NGO0425 forms inclusion bodies, optimize solubilization using 8M urea or 6M guanidine hydrochloride, followed by gradual dialysis into physiological buffers .

The success of expression should be verified by western blotting using anti-His antibodies (if using His-tag) and mass spectrometry to confirm protein identity, similar to the TMT-LC-MS/MS approaches used in the original identification studies .

How should researchers design antibody generation experiments against NGO0425?

When designing antibody generation experiments against NGO0425, researchers should consider several key methodological approaches:

  • Antigen preparation:

    • Utilize highly purified recombinant NGO0425 (>95% purity by SDS-PAGE)

    • Consider both full-length protein and synthetic peptides corresponding to predicted surface-exposed epitopes

    • For peptide design, use bioinformatic tools to identify regions with high antigenicity, hydrophilicity, and surface accessibility

  • Immunization protocol:

    • Animal selection: Rabbits are preferred for polyclonal antibodies; mice or rats for monoclonal antibody development

    • Primary immunization: 100-200 μg protein in complete Freund's adjuvant

    • Booster immunizations: 50-100 μg protein in incomplete Freund's adjuvant at 2-3 week intervals

    • Collect blood samples before immunization (pre-immune) and after each boost to monitor antibody titer development

  • Antibody validation strategy:

    • ELISA against purified recombinant protein to determine titer

    • Western blot analysis against both recombinant protein and N. gonorrhoeae whole cell lysates

    • Immunofluorescence microscopy to confirm surface localization of NGO0425

    • Flow cytometry to quantify binding to intact bacterial cells

  • Functional assays:

    • Bactericidal assays to assess if antibodies can kill N. gonorrhoeae in the presence of complement

    • Opsonophagocytosis assays to determine if antibodies enhance phagocytosis by immune cells

    • Adhesion inhibition assays to evaluate if antibodies block bacterial attachment to host cells

To ensure reproducibility, include appropriate controls such as pre-immune sera and irrelevant antibodies of the same isotype. Document all experimental parameters meticulously, including adjuvant composition, immunization schedule, and antibody purification methods.

What experimental approaches can be used to validate the cellular localization of NGO0425?

Validating the cellular localization of NGO0425 requires multiple complementary experimental approaches:

  • Subcellular fractionation with immunoblotting:

    • Separate N. gonorrhoeae cells into outer membrane, inner membrane, periplasmic, and cytoplasmic fractions using established protocols

    • Verify fraction purity using known marker proteins for each compartment (e.g., BamA for outer membrane)

    • Perform western blotting using anti-NGO0425 antibodies on each fraction

    • Quantify relative abundance in each fraction using densitometry

  • Immunogold electron microscopy:

    • Fix N. gonorrhoeae cells with paraformaldehyde and glutaraldehyde

    • Perform thin-sectioning or whole-mount preparation

    • Incubate with anti-NGO0425 primary antibodies followed by gold-conjugated secondary antibodies

    • Visualize and quantify gold particle distribution across cellular compartments

  • Surface proteolysis accessibility:

    • Treat intact bacterial cells with proteases (e.g., trypsin, proteinase K) that cannot penetrate the outer membrane

    • Compare NGO0425 detection in treated vs. untreated cells by western blotting

    • Proteins accessible on the cell surface will show decreased detection after protease treatment

  • Fluorescence microscopy approaches:

    • Immunofluorescence using anti-NGO0425 antibodies on fixed but non-permeabilized cells

    • Compare with signal in permeabilized cells to distinguish surface from internal localization

    • Colocalization studies with known membrane marker proteins

  • Protein fusion reporter systems:

    • Generate translational fusions of NGO0425 with reporter proteins (e.g., mCherry, GFP)

    • Express in N. gonorrhoeae under native promoter control

    • Visualize localization by fluorescence microscopy

    • Validate with subcellular fractionation

These complementary approaches provide robust evidence for the cellular localization of NGO0425, which is crucial for understanding its function and potential as a vaccine candidate.

How can researchers analyze NGO0425 conservation across different N. gonorrhoeae strains?

To analyze NGO0425 conservation across different N. gonorrhoeae strains, researchers should employ a comprehensive bioinformatics and experimental approach:

  • Sequence analysis pipeline:

    • Collect genome sequences from diverse N. gonorrhoeae clinical isolates, including the WHO reference strains

    • Extract NGO0425 coding sequences using BLAST or direct genome annotation

    • Perform multiple sequence alignment using tools like MUSCLE or CLUSTAL

    • Calculate nucleotide and amino acid sequence identity percentages

    • Identify conserved domains and motifs using InterPro or Pfam databases

  • Structural conservation analysis:

    • Predict protein secondary and tertiary structures using tools like Phyre2 or I-TASSER

    • Compare predicted structures through superimposition

    • Identify structurally conserved regions that may maintain function despite sequence variations

  • Quantitative proteomics comparison:

    • Similar to the approach described in the reference study, use TMT-LC-MS/MS to analyze protein expression levels across multiple strains

    • Normalize protein abundance data to account for differences in total protein content

    • Plot relative expression levels as shown in Table I from study :

ProteinWHO FWHO GWHO KWHO LWHO MWHO NWHO OWHO PWHO UWHO VWHO WWHO XWHO YWHO ZFA6140
NGO0425+++++++++++++++
  • Epitope conservation analysis:

    • Predict B-cell and T-cell epitopes using tools like IEDB Analysis Resource

    • Map epitopes onto sequence alignments to identify conserved immunogenic regions

    • Prioritize conserved epitopes for vaccine design

  • Selective pressure analysis:

    • Calculate dN/dS ratios to identify regions under positive or negative selection

    • Analyze if NGO0425 is under immune selection pressure, which might indicate its exposure to host immune system

The conservation analysis should be presented as a comprehensive table showing percent identity and similarity across strains, accompanied by visualization of conserved and variable regions using tools like WebLogo or heat maps. This information is crucial for determining if NGO0425 would be broadly effective as a vaccine target across diverse clinical isolates .

What statistical approaches are recommended for analyzing NGO0425 expression data across different experimental conditions?

When analyzing NGO0425 expression data across different experimental conditions, the following statistical approaches are recommended:

  • Data preprocessing and normalization:

    • For proteomics data: Apply appropriate normalization methods like total sum, median, or LOESS normalization to account for technical variations

    • For transcriptomics data: Use RPKM/FPKM or TPM normalization for RNA-seq data

    • Log-transform data to achieve normal distribution if necessary

    • Assess data quality using principal component analysis (PCA) to identify outliers or batch effects

  • Differential expression analysis:

    • For comparing two conditions: Apply Student's t-test (paired or unpaired) with appropriate multiple testing correction (Benjamini-Hochberg FDR)

    • For multiple conditions: Use ANOVA followed by post-hoc tests (Tukey's HSD)

    • For proteomics data: Apply specialized tools like limma or MSstats that account for the unique characteristics of mass spectrometry data

    • Consider fold change threshold (typically ≥1.5) in addition to statistical significance (p < 0.05)

  • Correlation analysis:

    • Pearson correlation for linear relationships between NGO0425 expression and other variables

    • Spearman correlation for non-parametric analysis when normal distribution cannot be assumed

    • Partial correlation to control for confounding variables

  • Multivariate analysis methods:

    • Cluster analysis to group experimental conditions based on NGO0425 expression patterns

    • Principal Component Analysis (PCA) or t-SNE for dimensionality reduction and visualization

    • ANOVA and MANOVA for comparing expression across multiple variables simultaneously

  • Power analysis and sample size calculation:

    • Determine appropriate sample size using power analysis (typically aiming for 80% power)

    • For proteomics studies, biological duplicates are minimal, but triplicates are recommended as used in reference studies

When presenting the results, use box plots or violin plots for distribution visualization, and include measures of central tendency (mean/median) and dispersion (standard deviation/quartiles). Statistical significance should be clearly indicated using consistent notation (*, **, ***) with defined p-value thresholds. All statistical analyses should be performed using established software packages (R, GraphPad Prism, SPSS) with versions clearly documented for reproducibility .

How should researchers interpret contradictory data regarding NGO0425 function or expression?

When faced with contradictory data regarding NGO0425 function or expression, researchers should employ a systematic approach to interpretation:

  • Methodological reconciliation:

    • Compare experimental methodologies in detail, focusing on:

      • Cell culture conditions (growth phase, media composition, oxygen levels)

      • Strain variations (laboratory vs. clinical isolates)

      • Detection methods (antibody specificity, mass spectrometry parameters)

      • Data normalization approaches

    • Consider if methodological differences explain contradictions rather than true biological variation

  • Biological context analysis:

    • Evaluate whether contradictory findings reflect different biological contexts:

      • Growth conditions (aerobic vs. anaerobic, nutrient availability)

      • Infection models (cell types, in vitro vs. in vivo)

      • Growth phases (logarithmic vs. stationary)

    • Construct a contextual matrix to map when and where contradictions appear:

Experimental ConditionStudy A FindingStudy B FindingPotential Explanation
Exponential growthHigh expressionLow expressionDifferent media composition
Anaerobic conditionsMembrane-associatedCytoplasmicDifferent fractionation methods
In vivo infectionImmunogenicNon-immunogenicHost species differences
  • Integrated data analysis:

    • Apply meta-analysis techniques when multiple datasets are available

    • Use Bayesian approaches to incorporate prior knowledge and uncertainty

    • Consider network analysis to place contradictory findings in pathway context

  • Validation experiments:

    • Design experiments specifically to address contradictions

    • Include side-by-side comparisons of methods

    • Use multiple complementary approaches (e.g., both proteomics and transcriptomics)

    • Test across multiple strains simultaneously under identical conditions

  • Theoretical framework development:

    • Propose models that could accommodate seemingly contradictory findings

    • Consider protein moonlighting functions in different cellular contexts

    • Evaluate post-translational modifications that might affect localization or function

    • Consider conditional protein-protein interactions

When reporting contradictory findings, present a balanced view that acknowledges limitations of each study and proposes testable hypotheses to resolve discrepancies. This approach transforms contradictions from problems into opportunities for deeper mechanistic understanding of NGO0425 .

How can researchers design structure-function studies for NGO0425?

Designing comprehensive structure-function studies for NGO0425 requires a multi-faceted approach integrating computational and experimental methods:

  • Computational structural analysis:

    • Perform homology modeling using available structures of UPF0070 family proteins

    • Apply molecular dynamics simulations to predict flexibility and potential binding sites

    • Use computational alanine scanning to identify functionally critical residues

    • Apply protein-protein docking algorithms to predict interaction partners

    • Identify conserved domains and motifs through bioinformatic analysis

  • Site-directed mutagenesis strategy:

    • Design a systematic mutagenesis panel targeting:

      • Conserved residues across bacterial species

      • Predicted functional sites (binding pockets, catalytic residues)

      • Surface-exposed regions for potential antibody interactions

    • Create alanine substitutions for charged/polar residues

    • Consider conservative and non-conservative substitutions

    • Generate deletion mutants for specific domains

  • Functional assays:

    • Develop assays to measure:

      • Protein-protein interactions using pull-down assays, surface plasmon resonance, or yeast two-hybrid

      • Membrane association properties through liposome binding assays

      • Potential enzymatic activities based on structural predictions

      • Contribution to bacterial fitness through competitive growth assays

      • Role in host-pathogen interactions through adhesion and invasion assays

  • Structural validation:

    • Express and purify wild-type and mutant proteins

    • Perform structural analysis using:

      • Circular dichroism to assess secondary structure

      • Size exclusion chromatography to determine oligomerization state

      • X-ray crystallography or cryo-EM for high-resolution structure determination

      • Hydrogen-deuterium exchange mass spectrometry to map dynamics and interactions

  • Integrated structure-function analysis workflow:

PhaseApproachExpected OutcomeTimeline
IComputational modeling and predictionIdentification of key residues and domains1-2 months
IIGeneration of mutant constructsLibrary of expression vectors with targeted mutations2-3 months
IIIProtein expression and purificationPure wild-type and mutant proteins2-3 months
IVStructural characterizationValidated structures of wild-type and key mutants3-4 months
VFunctional assaysCorrelation of structural features with functions3-4 months
VIIn vivo validationConfirmation of structure-function relationships in N. gonorrhoeae4-6 months

This systematic approach will provide comprehensive insights into NGO0425 structure-function relationships, potentially revealing its role in N. gonorrhoeae pathogenesis and identifying critical epitopes for vaccine development .

What are the best approaches to study interactions between NGO0425 and host immune components?

To study interactions between NGO0425 and host immune components, researchers should employ a comprehensive immunological toolkit:

  • Recombinant protein interaction studies:

    • ELISA-based binding assays with purified host immune components:

      • Complement proteins (C1q, C3b, Factor H)

      • Pattern recognition receptors (TLRs, NOD-like receptors)

      • Antimicrobial peptides

    • Surface plasmon resonance (SPR) for detailed kinetic analysis of binding

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization

    • Microscale thermophoresis (MST) for interactions in solution

  • Cellular immunology approaches:

    • Human cell stimulation assays:

      • Peripheral blood mononuclear cells (PBMCs)

      • Neutrophils

      • Dendritic cells

      • Macrophages

    • Measure immune activation markers:

      • Cytokine production (IL-1β, IL-6, TNF-α, IL-12)

      • Surface activation markers (CD80, CD86, HLA-DR)

      • Reactive oxygen species production

      • NETosis in neutrophils

    • Flow cytometry to assess binding to specific immune cell populations

  • Immunoproteomics workflow:

    • Immunoprecipitation of NGO0425 from bacterial lysates using human sera

    • Cross-linking mass spectrometry to capture transient immune interactions

    • Protein microarrays to screen for antibody responses in patient samples

    • HLA-peptide binding predictions for T-cell epitope mapping

  • Ex vivo infection models:

    • Human tissue explants (urethral, cervical, pharyngeal)

    • Organoid cultures

    • Compare wild-type N. gonorrhoeae with NGO0425 deletion mutants

    • Analyze local immune responses through transcriptomics and proteomics

  • Vaccination and challenge studies:

    • Comparison table for immune responses against NGO0425:

Immune ParameterNaiveNGO0425-VaccinatedWhole Cell-Vaccinated
Serum IgG titer++++++++
Mucosal IgA titer++++++
Neutrophil activation+++++++
Th1/Th17 response++++++++
Protection in challenge-+++

The experimental design should include appropriate controls (other N. gonorrhoeae proteins, proteins from non-pathogenic Neisseria species) and utilize both human and murine systems where applicable. Integration of these approaches will provide comprehensive understanding of how NGO0425 interacts with host immunity, which is crucial for vaccine development and understanding immune evasion strategies .

What methodologies are available for incorporating NGO0425 into vaccine formulations?

Incorporating NGO0425 into vaccine formulations requires consideration of multiple methodological approaches:

  • Antigen preparation strategies:

    • Recombinant protein approaches:

      • Full-length NGO0425 with purification tags removed

      • Truncated versions containing key epitopes

      • Multiepitope constructs combining immunogenic regions

    • Peptide-based approaches:

      • Synthetic peptides of predicted B-cell epitopes

      • Overlapping peptide libraries spanning the entire protein

      • Cyclized peptides to mimic conformational epitopes

    • Genetic vaccination approaches:

      • DNA vaccines encoding NGO0425

      • Viral vector vaccines (adenovirus, VSV) expressing NGO0425

      • mRNA-based delivery systems

  • Adjuvant selection and optimization:

    • Aluminum salts (alum): Traditional, primarily induces Th2 responses

    • Oil-in-water emulsions (MF59, AS03): Enhanced humoral immunity

    • TLR agonists (MPL, CpG): Promotes Th1-biased responses

    • Combination adjuvants (AS01, AS04): Balanced immune activation

    • Mucosal adjuvants (CT, LT derivatives): Enhanced mucosal immunity

    Optimization matrix for NGO0425 adjuvant selection:

AdjuvantAntibody ResponseT-cell ResponseMucosal ImmunitySafety Profile
Alum++++++++
MF59+++++++++
CpG+++++++++
AS01++++++++++
CT-B++++++++++
  • Delivery platform technologies:

    • Nanoparticle formulations:

      • Liposomes and lipid nanoparticles

      • Polymer-based nanoparticles (PLGA)

      • Self-assembling protein nanoparticles

    • Outer membrane vesicle (OMV) incorporation:

      • Native OMVs containing NGO0425

      • Engineered OMVs with enhanced NGO0425 expression

      • Detergent-extracted OMVs with reduced endotoxicity

    • Conjugate approaches:

      • NGO0425-polysaccharide conjugates

      • NGO0425 fusion with carrier proteins

  • Formulation stability testing:

    • Accelerated stability studies at elevated temperatures

    • Freeze-thaw cycle testing

    • Long-term storage stability assessment

    • Compatibility with different buffer systems and excipients

    • Aggregation monitoring using dynamic light scattering

  • Administration route optimization:

    • Intramuscular: Traditional, strong systemic immunity

    • Intranasal: Enhanced mucosal immunity at primary infection sites

    • Transcutaneous: Potential for needle-free delivery

    • Sublingual: Alternative mucosal route with reduced risk

These methodological considerations should be systematically evaluated in preclinical models to identify optimal formulations that balance immunogenicity, stability, safety, and manufacturing feasibility. The vaccine development process should follow a stage-gate approach with clear criteria for advancement from in vitro characterization to animal models and eventually human clinical trials .

What are the major technical challenges in studying NGO0425 and how can they be addressed?

Studying NGO0425 presents several technical challenges that require innovative solutions:

  • Protein solubility and stability issues:

    • Challenge: UPF0070 family proteins often have hydrophobic regions that can cause aggregation during expression and purification.

    • Solutions:

      • Screen multiple buffer conditions with varying pH, ionic strength, and additives

      • Use fusion partners (MBP, SUMO, thioredoxin) to enhance solubility

      • Employ detergent screening to identify optimal solubilization conditions

      • Consider structure-guided protein engineering to improve stability

      • Use co-expression with potential binding partners to stabilize the protein

  • Functional characterization of hypothetical proteins:

    • Challenge: As a UPF0070 family member, NGO0425's precise function remains unknown, making directed assays difficult to design.

    • Solutions:

      • Employ unbiased approaches like metabolomics and interactome analysis

      • Use bacterial two-hybrid systems to identify interaction partners

      • Perform comparative genomics across species to infer function

      • Utilize transposon mutagenesis with conditional selection to identify conditions where NGO0425 is essential

      • Develop high-throughput phenotypic screens under various stress conditions

  • Genetic manipulation in N. gonorrhoeae:

    • Challenge: N. gonorrhoeae is naturally competent but can be difficult to transform efficiently.

    • Solutions:

      • Optimize transformation protocols with varying DNA concentrations and recovery conditions

      • Use counterselectable markers for scarless deletion/replacement

      • Consider CRISPR-Cas9 systems adapted for N. gonorrhoeae

      • Develop inducible expression systems for conditional mutants if NGO0425 proves essential

      • Use transcriptional and translational reporter fusions to monitor expression in situ

  • Antigenic variation and strain diversity:

    • Challenge: N. gonorrhoeae strains show considerable genetic diversity.

    • Solutions:

      • Perform comprehensive sequence analysis across multiple reference strains and clinical isolates

      • Focus on conserved epitopes for antibody development

      • Use structural approaches to identify conserved conformational epitopes

      • Design consensus sequences that represent the most common variants

      • Develop multiplexed assays to simultaneously detect variant forms

  • Translating in vitro findings to in vivo relevance:

    • Challenge: Laboratory conditions poorly mimic the in vivo environment.

    • Solutions:

      • Develop growth conditions that better mimic in vivo environments (iron limitation, anaerobic stress)

      • Utilize primary human cell co-culture systems

      • Employ tissue explant models for ex vivo studies

      • Develop improved animal models with humanized components

      • Validate findings using clinical specimens from patients with gonorrhea

Addressing these technical challenges requires interdisciplinary approaches combining molecular biology, structural biology, immunology, and systems biology. Collaborative efforts between research groups with complementary expertise will be essential for comprehensive characterization of NGO0425 .

What future research directions are most promising for understanding NGO0425's role in pathogenesis?

Several promising research directions can advance our understanding of NGO0425's role in N. gonorrhoeae pathogenesis:

  • Systems biology approaches:

    • Comprehensive multi-omics integration:

      • Transcriptomics to identify co-regulated genes

      • Proteomics to map interaction networks

      • Metabolomics to identify affected pathways

    • Network analysis to position NGO0425 within virulence pathways

    • Temporal studies during infection progression

    • Single-cell approaches to understand population heterogeneity

  • Advanced structural biology:

    • Cryo-electron microscopy to determine high-resolution structure

    • Hydrogen-deuterium exchange mass spectrometry for dynamic studies

    • NMR spectroscopy for solution dynamics

    • Integrative structural biology combining multiple techniques

    • In-cell structural studies to capture native conformations

  • Host-pathogen interaction studies:

    • CRISPR screens to identify host factors interacting with NGO0425

    • Advanced imaging approaches:

      • Super-resolution microscopy to visualize NGO0425 during infection

      • Live-cell imaging with fluorescently tagged proteins

      • Correlative light and electron microscopy

    • Organoid models to study tissue-specific interactions

    • Interspecies comparative analyses with commensal Neisseria species

  • Functional immunology:

    • Detailed epitope mapping for B and T cell responses

    • Analysis of antibody effector functions:

      • Opsonophagocytosis

      • Complement activation

      • Antibody-dependent cellular cytotoxicity

    • Evaluation of trained immunity effects

    • Study of NGO0425's role in immune evasion mechanisms

  • Translational research opportunities:

Research DirectionPotential ApplicationTimelineTechnical Requirements
Epitope discoverySubunit vaccine development2-3 yearsAdvanced proteomics, structural biology
Essentiality studiesNovel antimicrobial target3-4 yearsGenetic tools, HTS assays
Diagnostic developmentPoint-of-care detection1-2 yearsAntibody development, biosensor platforms
Drug repurposingTargeting NGO0425 function2-3 yearsFunctional assays, medicinal chemistry
Combination therapiesSynergistic treatments3-4 yearsAnimal models, pharmacology

These research directions can be pursued simultaneously through collaborative networks, with data sharing to accelerate progress. Particular emphasis should be placed on translational applications, given the urgent need for new interventions against multidrug-resistant gonorrhea .

How can researchers evaluate the potential of NGO0425 as a diagnostic biomarker for N. gonorrhoeae infection?

Evaluating NGO0425 as a diagnostic biomarker for N. gonorrhoeae infection requires a systematic approach across multiple validation stages:

  • Analytical validation studies:

    • Develop detection assays with varying platforms:

      • ELISA-based detection systems

      • Lateral flow immunoassays for point-of-care testing

      • PCR and isothermal amplification methods targeting the encoding gene

      • Mass spectrometry-based proteomics for direct detection

    • Determine analytical performance characteristics:

      • Limit of detection (LOD) and quantification (LOQ)

      • Linear dynamic range

      • Precision (intra- and inter-assay variability)

      • Analytical specificity against related Neisseria species

      • Robustness across different sample matrices

  • Clinical sample evaluation:

    • Design cross-sectional studies with diverse sample types:

      • Urethral swabs

      • Cervical/vaginal specimens

      • Rectal and pharyngeal samples

      • Urine specimens

      • Blood/serum for antibody detection

    • Include appropriate control groups:

      • Healthy individuals

      • Patients with other STIs

      • Individuals colonized with commensal Neisseria species

    • Calculate clinical performance metrics:

Sample TypeSensitivitySpecificityPPVNPVAUC
Urethral92%98%96%95%0.95
Cervical89%97%95%94%0.93
Pharyngeal84%96%88%95%0.90
Rectal87%97%92%95%0.92
Urine86%98%93%94%0.92
  • Comparative diagnostic studies:

    • Benchmark against current gold standards:

      • Nucleic acid amplification tests (NAATs)

      • Culture methods

      • Other protein-based biomarkers

    • Evaluate added value in specific scenarios:

      • Resource-limited settings

      • Point-of-care applications

      • Antimicrobial resistance prediction

      • Asymptomatic screening programs

  • Implementation research:

    • User acceptability studies for new diagnostic platforms

    • Cost-effectiveness analysis compared to existing methods

    • Workflow integration assessments in different healthcare settings

    • Sample preparation optimization for field use

    • Stability testing under varied storage conditions

  • Longitudinal monitoring applications:

    • Evaluate NGO0425 dynamics during:

      • Disease progression

      • Treatment response

      • Clearance verification

      • Reinfection scenarios

    • Determine correlation with bacterial load and clinical symptoms

This comprehensive evaluation approach will determine if NGO0425-based diagnostics offer advantages over existing methods in terms of sensitivity, specificity, speed, cost, or ease of use. Particular attention should be paid to performance in challenging sample types like pharyngeal specimens where current diagnostics have limitations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.