Recombinant Neisseria meningitidis serogroup A / serotype 4A Biopolymer transport protein exbB (exbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Iron Uptake

ExbB is part of the TonB system, which enables N. meningitidis to scavenge iron from host proteins. This system includes:

  • TonB: A cytoplasmic membrane protein that transmits energy from the proton motive force.

  • ExbB/ExbD: Periplasmic proteins that interact with TonB to facilitate iron release from receptors.

Key Findings:

  • Iron Source Utilization: N. meningitidis mutants lacking tonB or exbD genes cannot utilize hemoglobin, transferrin, or lactoferrin as iron sources .

  • Heme Utilization: TonB-independent mechanisms exist for heme uptake, as mutants still utilize heme efficiently .

  • Complementation Studies: The neisserial Ton system cannot interact with E. coli FhuA receptors, indicating species-specific interactions .

Experimental Challenges and Insights

  • Mutant Phenotypes: exbD mutants exhibit a "leaky" phenotype, suggesting residual iron uptake via alternative pathways .

  • HmbR Dependency: ExbB functions in conjunction with the HmbR receptor for hemoglobin binding .

  • Species-Specific Interactions: The N. meningitidis TonB system does not complement E. coli TonB-dependent receptors, highlighting evolutionary divergence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us for preferential development.
Synonyms
exbB; NMA1984; Biopolymer transport protein ExbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
exbB
Target Protein Sequence
MNLKLVFESGDPVLIGVFVLMLLMSIVTWCLVVLRCIKLYRARKGNAAVKRHMRDTLSLN DAVEKVRAVDAPLSKLAQEALQSYRNYRRNEASELAQALPLNEYLVIQIRNSMAQIMRRF DYGMTALASIGATAPFIGLFGTVWGIYHALINIGQSGQMSIAAVAGPIGEALVATAAGLF VAIPAVLAYNFLNRGTKILTQDLDAMAHDLHVRLLNQKDS
Uniprot No.

Target Background

Function

ExbB is involved in TonB-dependent, energy-transducing transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.

Database Links

KEGG: nma:NMA1984

Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ExbB in Neisseria meningitidis?

ExbB is a critical component of the TonB-dependent transport system in Neisseria meningitidis, functioning as part of a protein complex that includes ExbD and TonB. This system is essential for the utilization of protein-bound iron, which is a crucial nutrient for bacterial survival and pathogenesis. The ExbB protein is located in the cytoplasmic membrane and works to transduce energy from the proton motive force to TonB, which then interacts with specific outer membrane receptors to facilitate the uptake of iron-containing compounds across the outer membrane . Mutation studies have demonstrated that the TonB system in N. meningitidis, including ExbB, is required for the utilization of hemoglobin, hemoglobin-haptoglobin complexes, transferrin, and lactoferrin as iron sources .

How does the ExbB protein interact with other components of the TonB system?

The interaction between ExbB, ExbD, and TonB forms a functional complex that energizes the transport of iron-containing compounds across the outer membrane. ExbB appears to be the central component of this complex, with multiple copies forming a channel-like structure in the cytoplasmic membrane. Research indicates that ExbB and ExbD work together to harness the proton motive force and transfer this energy to TonB . Sequence analysis reveals that N. meningitidis ExbB shares 24.7% to 36.1% amino acid identity with ExbB proteins from other gram-negative bacteria, while also showing homology with TolQ proteins . This structural conservation suggests functional importance across different bacterial species despite relatively low sequence identity.

What is the genetic organization of the exbB locus in Neisseria meningitidis?

In N. meningitidis, the exbB gene is typically found in an operon arrangement with exbD and tonB genes. Nucleotide sequence analysis has identified these three genes in close proximity, suggesting coordinated expression . The arrangement typically follows the order tonB-exbB-exbD. Downstream of the exbD gene, a perfect 31-bp inverted repeat sequence (AATGCCGTCTGAAAGTCTTTCAGACGGCAT) has been identified, which may function as a transcriptional terminator . Interestingly, this sequence is also part of the N. meningitidis IS1106 insertion element, suggesting potential evolutionary or regulatory significance . This genetic organization facilitates the coordinated expression of all three components required for the functional TonB-dependent transport system.

What are the most effective methods for generating exbB mutants in Neisseria meningitidis?

Generating exbB mutants in N. meningitidis requires careful consideration of both the genetic tools available and the specific research questions. One effective approach involves insertional inactivation using antibiotic resistance cassettes. As demonstrated in research with the related exbD gene, linearized plasmids containing an antibiotic resistance marker (such as kanamycin) inserted into the target gene can be transformed into N. meningitidis strains . This approach allows for selection of mutants on antibiotic-containing media.

For more precise genetic manipulation, researchers can employ PCR-based site-directed mutagenesis or CRISPR-Cas9 systems adapted for Neisseria. When designing such experiments, it is essential to consider the potential polar effects on downstream genes in the tonB-exbB-exbD operon. To avoid such effects, markerless deletion methods or the use of promoters to drive expression of downstream genes may be necessary. Verification of mutants should include both PCR confirmation of the genetic change and functional assays to assess iron utilization from various sources.

How can researchers effectively isolate and purify ExbB protein for structural and functional studies?

Isolation and purification of N. meningitidis ExbB protein presents challenges due to its membrane-associated nature. A systematic approach combining membrane fraction isolation with affinity chromatography yields the best results. Begin by expressing the protein with an affinity tag (His6 or FLAG) either in the native organism or in a heterologous expression system such as E. coli. For membrane protein isolation, the protocol used for E. coli outer membrane preparation can be adapted :

  • Culture bacteria under iron-limited conditions to induce expression of iron acquisition systems

  • Harvest cells and create spheroplasts using lysozyme in a Tris-sucrose buffer

  • Solubilize membranes using 2% Triton X-100 in buffer containing 50 mM Tris and 10 mM MgCl₂

  • Separate outer membranes by ultracentrifugation at 40,000 × g for 1 hour at 4°C

  • Wash the membrane pellet thoroughly to remove cytoplasmic contaminants

For purification of ExbB specifically, solubilize the membrane fraction with appropriate detergents (DDM or LDAO are often effective) followed by affinity chromatography targeting the engineered tag. Size exclusion chromatography can further improve purity. Protein activity should be verified using reconstitution assays or binding studies with labeled TonB or ExbD partners.

What assays can be used to measure ExbB function in vitro and in vivo?

Multiple complementary approaches can assess ExbB functionality across different experimental contexts:

In vivo assays:

  • Growth assays using defined media with various iron sources (hemoglobin, transferrin, lactoferrin) can evaluate the ability of wild-type versus exbB mutant strains to utilize protein-bound iron

  • Radioactive iron (⁵⁵Fe) uptake assays can quantitatively measure iron acquisition rates

  • Biotinylated hemoglobin binding assays can assess receptor-ligand interactions dependent on the TonB system

In vitro assays:

  • Proton flux measurements in proteoliposomes containing reconstituted ExbB-ExbD complexes

  • Protein-protein interaction studies using pull-down assays, surface plasmon resonance, or isothermal titration calorimetry to assess ExbB interactions with TonB and ExbD

  • Structural analysis through X-ray crystallography or cryo-electron microscopy

For functional complementation studies, researchers can follow the approach used with E. coli, where N. meningitidis exbB was shown to complement E. coli mutants for hemoglobin utilization when co-expressed with the appropriate receptor .

How does ExbB contribute to Neisseria meningitidis virulence and survival in the host?

ExbB plays a crucial role in N. meningitidis virulence through its essential function in iron acquisition. Iron is severely restricted in the human host through nutritional immunity mechanisms, making efficient iron uptake systems vital for bacterial survival and pathogenesis. The ExbB protein, as part of the TonB system, enables meningococci to extract iron from host proteins including hemoglobin, hemoglobin-haptoglobin complexes, transferrin, and lactoferrin .

Experimental evidence from tonB mutants demonstrates that disruption of this system renders N. meningitidis unable to utilize these host iron sources . This impairment would significantly reduce bacterial survival in vivo, as free iron is extremely limited in human fluids and tissues. The ability to acquire iron from multiple host sources provides N. meningitidis with metabolic flexibility during infection, allowing adaptation to different microenvironments within the host. This adaptability likely contributes to the organism's ability to cause both nasopharyngeal colonization and invasive disease, including meningitis and septicemia.

What is the relationship between ExbB function and vaccine development against Neisseria meningitidis?

While ExbB itself is not a component of current meningococcal vaccines, understanding TonB-dependent transport systems is relevant to vaccine development for several reasons. Current recombinant protein-based vaccines against serogroup B meningococci, such as 4CMenB (Bexsero), target outer membrane proteins including factor H-binding protein (fHbp), Neisserial adhesin A (NadA), Neisseria heparin-binding antigen (NHBA), and porin A (PorA) . Several of these vaccine targets are involved in nutrient acquisition pathways that may interact with TonB-dependent systems.

The efficacy of 4CMenB has been demonstrated in clinical trials, with one study showing that 79-100% of infants achieved protective antibody titers against the vaccine components after primary vaccination, and 92-99% after booster vaccination . Understanding how ExbB and the TonB system influence the expression and function of these vaccine targets could potentially inform future vaccine design. Additionally, as TonB-dependent receptors are essential for bacterial survival, they represent potential vaccine targets themselves, making the study of ExbB and its role in their function relevant to future vaccine development strategies.

How does iron availability affect expression of ExbB and related proteins in Neisseria meningitidis?

Expression of iron acquisition systems in N. meningitidis, including the TonB-ExbB-ExbD complex, is tightly regulated by iron availability through the ferric uptake regulator (Fur) protein. Under iron-replete conditions, Fur binds to specific DNA sequences (Fur boxes) in the promoter regions of iron-regulated genes, repressing their transcription. When iron is limited, as in the human host, Fur dissociates from DNA, allowing transcription of genes involved in iron acquisition.

Research with related Neisseria species and other gram-negative bacteria suggests that exbB expression is upregulated under iron limitation. Experimental approaches to study this regulation include:

  • qRT-PCR analysis of exbB mRNA levels under varying iron concentrations

  • Reporter gene fusions (e.g., lacZ or gfp) to the exbB promoter to monitor expression

  • Proteomic analysis comparing membrane protein profiles under iron-replete and iron-limited conditions

Understanding these regulatory mechanisms is crucial for interpreting experimental results, as the iron status of the bacterial culture can significantly impact ExbB expression levels and subsequent phenotypes observed in functional assays.

What genetic tools are available for studying ExbB function in Neisseria meningitidis?

Researchers studying ExbB in N. meningitidis can employ a diverse toolkit of genetic methods:

Gene inactivation approaches:

  • Insertional mutagenesis using antibiotic resistance cassettes

  • Markerless deletion strategies using counterselectable markers

  • CRISPR-Cas9 systems adapted for Neisseria species

Expression systems:

  • Inducible promoters (such as lac or tet) for controlled expression

  • Complementation plasmids for genetic rescue experiments

  • Epitope or fluorescent protein tagging for protein localization studies

Heterologous expression:

  • Reconstitution of N. meningitidis iron uptake systems in E. coli as demonstrated by previous research, allowing isolation of specific components of complex systems

  • Expression in defined backgrounds lacking endogenous Ton systems

Reporter systems:

  • Transcriptional fusions to monitor gene expression

  • Protein fusions to track localization or interaction partners

When designing genetic experiments, it's important to consider that complete tonB system mutants may have growth defects under iron-limited conditions, potentially complicating interpretation of results. Conditional or inducible systems may be necessary to separate direct effects of exbB mutation from secondary effects caused by iron starvation.

How do exbB homologs differ between Neisseria species and strains?

Comparative genomic analysis reveals both conservation and diversity in exbB sequences across Neisseria species and strains. The N. meningitidis ExbB protein shares significant homology with ExbB from other gram-negative bacteria, with sequence identity ranging from 24.7% to 36.1% . This moderate level of sequence conservation suggests functional constraints on protein structure despite considerable sequence divergence.

Within Neisseria species, sequence variation in exbB may reflect adaptation to different host environments or iron sources. For example, N. meningitidis primarily infects humans, while other Neisseria species colonize different hosts or environmental niches. These different ecological contexts may drive selection for specific ExbB variants optimized for particular iron acquisition strategies.

When studying exbB in a specific N. meningitidis strain, researchers should consider:

  • Comparing the sequence with reference strains to identify any unusual variations

  • Examining associated tonB and exbD sequences, as co-evolution of these interacting proteins is common

  • Analyzing variation in promoter regions that may affect expression levels

Sequence polymorphisms in exbB could potentially affect protein function, stability, or interactions with partner proteins, which may contribute to strain-specific differences in iron acquisition efficiency or host adaptation.

What approaches can be used to study potential interactions between ExbB and other membrane proteins?

Investigating ExbB interactions with other membrane proteins requires specialized techniques suitable for membrane protein complexes:

In vivo approaches:

  • Bacterial two-hybrid systems adapted for membrane proteins

  • In vivo crosslinking followed by co-immunoprecipitation

  • Fluorescence resonance energy transfer (FRET) between tagged proteins

  • Split-GFP complementation assays for protein-protein interactions

Biochemical methods:

  • Co-purification of protein complexes using tandem affinity purification (TAP)

  • Blue native PAGE to preserve native protein complexes

  • Chemical crosslinking coupled with mass spectrometry (XL-MS)

  • Surface plasmon resonance or microscale thermophoresis for quantitative binding studies

Structural approaches:

  • Cryo-electron microscopy of purified complexes

  • X-ray crystallography of co-purified proteins

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

A particularly valuable approach is genetic suppressor analysis, where secondary mutations that restore function to an exbB mutant may identify interacting partners. For instance, researchers reconstituted the N. meningitidis Hb utilization system in E. coli and found that the neisserial Ton system cannot interact with the E. coli FhuA TonB-dependent outer membrane receptor . This finding highlights the specificity of ExbB-TonB interactions with their cognate outer membrane receptors.

How does Neisseria meningitidis ExbB compare functionally to homologs in other gram-negative bacteria?

The ExbB protein in N. meningitidis shares both structural and functional similarities with its homologs in other gram-negative bacteria, yet displays important species-specific characteristics. Sequence analysis shows that N. meningitidis ExbB shares 24.7% to 36.1% amino acid identity with ExbB proteins from other species, including Pseudomonas putida, Escherichia coli, and Haemophilus influenzae . It also shows homology to TolQ proteins, which are part of the Tol system involved in maintaining outer membrane integrity .

Functionally, while the core role in energy transduction appears conserved, complementation studies have revealed species-specific interactions. For example, the N. meningitidis TonB system cannot functionally interact with the E. coli FhuA TonB-dependent outer membrane receptor . This specificity likely reflects co-evolution of the ExbB-ExbD-TonB complex with their cognate outer membrane receptors in each species.

Another notable difference is that N. meningitidis appears to possess a TonB-independent mechanism for heme utilization, as tonB and exbD mutants can still efficiently use heme as an iron source . This alternate pathway has not been described in many other gram-negative bacteria and represents a unique aspect of N. meningitidis iron acquisition systems.

What can we learn from E. coli ExbB studies that might apply to Neisseria meningitidis?

E. coli has served as a model organism for studying TonB-dependent transport, providing valuable insights that may inform research on N. meningitidis ExbB:

  • Structural organization: E. coli studies suggest ExbB forms oligomeric structures in the membrane, with multiple ExbB subunits interacting with fewer ExbD and TonB proteins. This architecture may be conserved in N. meningitidis and could guide structural biology approaches.

  • Energy transduction mechanism: Research in E. coli has elucidated how the ExbB-ExbD complex harnesses the proton motive force to energize TonB. The passage of protons through the ExbB channel induces conformational changes that are transmitted to TonB. Similar mechanisms likely operate in N. meningitidis.

  • Experimental approaches: Methods developed for E. coli, such as site-directed mutagenesis of key residues, can be adapted to identify functional domains in N. meningitidis ExbB. For example, the technique of isolating outer membranes from E. coli can be modified for use with N. meningitidis.

  • Heterologous expression: E. coli has proven useful as a heterologous host for expressing and studying N. meningitidis proteins. Researchers have successfully reconstituted the N. meningitidis hemoglobin utilization system in E. coli by expressing both the HmbR receptor and the TonB-ExbB-ExbD complex .

While insights from E. coli are valuable, researchers should remain aware of the species-specific aspects of TonB systems, as evidenced by the inability of the N. meningitidis Ton system to interact with E. coli receptors .

How do mutations in exbB affect TonB-dependent processes across different bacterial species?

Mutations in exbB have profound but somewhat variable effects on TonB-dependent processes across bacterial species. Common phenotypes resulting from exbB mutations include:

  • Impaired iron acquisition: In N. meningitidis, disruption of the TonB system renders bacteria unable to use hemoglobin, hemoglobin-haptoglobin complexes, transferrin, and lactoferrin as iron sources . Similar defects in iron acquisition are observed in other gram-negative bacteria.

  • Resistance to TonB-dependent bacteriophages and toxins: In E. coli, exbB mutations confer resistance to group B colicins and the antibiotic albomycin, which enter cells through TonB-dependent receptors . This phenotype demonstrates the role of ExbB in energy transduction to outer membrane receptors.

  • Species-specific effects: While the core phenotypes are similar, the specific manifestations vary based on the repertoire of TonB-dependent receptors in each species. For instance, N. meningitidis tonB mutants can still efficiently use heme , suggesting an alternative uptake pathway not present or not as efficient in other species.

  • Differential severity: Mutations in different regions of exbB can produce phenotypes of varying severity. For example, insertion of an antibiotic cassette in the 3' end of the related exbD gene in N. meningitidis produced a leaky phenotype with partial function retained . Similar position-dependent effects may occur with exbB mutations.

  • Growth defects: In iron-limited environments that mimic host conditions, exbB mutants typically show significant growth defects due to impaired iron acquisition, although the severity depends on the availability of alternative iron uptake systems.

These comparative observations help researchers understand both the conserved core functions of ExbB and the species-specific adaptations that have evolved in different bacterial lineages.

What are the challenges in determining the precise molecular mechanism of ExbB function?

Determining the precise molecular mechanism of ExbB function presents several significant challenges:

  • Membrane protein complexes: ExbB is part of a multi-protein complex embedded in the cytoplasmic membrane, making structural studies inherently difficult. Traditional techniques like X-ray crystallography are challenging to apply to membrane protein complexes.

  • Dynamic interactions: The ExbB-ExbD-TonB complex likely undergoes conformational changes during energy transduction. Capturing these transient states requires specialized approaches such as time-resolved structural methods or single-molecule techniques.

  • Functional reconstitution: Creating synthetic systems that accurately recapitulate in vivo function is technically challenging. While researchers have reconstituted the N. meningitidis hemoglobin utilization system in E. coli , fully reconstructing the energy transduction process in vitro requires proteoliposome systems with properly oriented proteins.

  • Proton translocation: Directly measuring proton movement through the ExbB-ExbD complex requires sophisticated electrophysiological approaches or pH-sensitive probes with high spatial and temporal resolution.

  • Species-specific differences: As demonstrated by the inability of N. meningitidis TonB to interact with E. coli receptors , there are species-specific aspects to these systems that complicate extrapolation from model organisms.

Addressing these challenges will likely require integrating multiple approaches, including cryo-electron microscopy, molecular dynamics simulations, site-directed mutagenesis of key residues, and advanced biophysical techniques to monitor conformational changes and energy transfer in real-time.

How might ExbB be targeted for antimicrobial development against Neisseria meningitidis?

The essential role of ExbB in iron acquisition makes it a potential target for novel antimicrobial strategies against N. meningitidis:

  • Small molecule inhibitors: Compounds that disrupt ExbB function or its interactions with ExbD and TonB could impair iron acquisition. Potential approaches include:

    • Structure-based drug design targeting the proton channel formed by ExbB

    • Inhibitors that prevent ExbB oligomerization

    • Peptide mimetics that disrupt protein-protein interactions within the TonB complex

  • Combination approaches: ExbB inhibitors could potentially sensitize N. meningitidis to existing antibiotics by restricting iron availability and metabolic activity. This approach might be particularly effective against strains resistant to conventional antibiotics.

  • Evaluation challenges: Several factors complicate development of ExbB-targeting antimicrobials:

    • Need for bacterial-specific activity to avoid toxicity to host cells

    • Requirement for membrane permeability to reach the cytoplasmic membrane target

    • Potential for resistance development through compensatory mutations

    • Existence of alternative iron acquisition pathways in N. meningitidis

  • Screening strategies: High-throughput approaches to identify ExbB inhibitors could include:

    • Growth inhibition assays under iron-limited conditions

    • Reporter systems that monitor TonB-dependent uptake

    • In vitro assays measuring proton flux through reconstituted ExbB-ExbD complexes

While challenging, targeting iron acquisition systems represents a promising alternative to conventional antibiotic approaches, particularly given the rise in antimicrobial resistance and the serious nature of meningococcal disease.

What experimental approaches could clarify the relationship between ExbB and the Ton-independent heme utilization pathway in Neisseria meningitidis?

The discovery that N. meningitidis tonB and exbD mutants can efficiently use heme suggests the existence of a Ton-independent heme utilization pathway. Elucidating this relationship requires systematic experimental approaches:

  • Genetic dissection:

    • Create double and triple mutants (exbB/known heme transporters)

    • Perform transposon mutagenesis in tonB mutant backgrounds to identify genes required for Ton-independent heme uptake

    • Conduct suppressor screens to identify mutations that restore heme utilization in compromised strains

  • Biochemical approaches:

    • Compare heme binding proteins present in wild-type versus tonB mutant membrane fractions

    • Perform radioactive or fluorescently labeled heme uptake assays in various genetic backgrounds

    • Identify proteins that directly interact with heme using pull-down assays or photocrosslinking

  • Comparative genomics:

    • Analyze N. meningitidis genome for homologs of known Ton-independent heme transporters from other species

    • Compare genomes of Neisseria species with different dependencies on the Ton system for heme utilization

    • Identify candidate genes unique to species with Ton-independent heme uptake capabilities

  • Expression profiling:

    • Perform RNA-seq comparing wild-type and tonB mutants grown with heme as the sole iron source

    • Use proteomics to identify differentially expressed membrane proteins

    • Employ ribosome profiling to identify genes translationally upregulated in response to tonB mutation

These approaches would help characterize this unique aspect of N. meningitidis iron acquisition and potentially reveal novel transport mechanisms that could be relevant to other pathogenic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.