Recombinant Neisseria meningitidis serogroup A / serotype 4A Capsule polysaccharide export inner-membrane protein CtrB (ctrB)

Shipped with Ice Packs
In Stock

Description

Introduction to Neisseria meningitidis and Capsule Polysaccharide Export

Neisseria meningitidis is a pathogenic bacterium that causes meningitis and other forms of invasive meningococcal disease . A key virulence factor of this bacterium is its polysaccharide capsule, which is essential for its survival and pathogenicity . Based on the serologic differences in the capsule, N. meningitidis has been classified into several serogroups, six of which (A, B, C, W, X, and Y) are responsible for most cases of invasive meningococcal disease . The capsule allows the bacterium to evade the host's immune system .

Role of CtrB in Capsule Polysaccharide Export

In N. meningitidis, the export of capsular polysaccharides to the bacterial surface is a complex process that involves several proteins . Among these, CtrB (Capsule transport B) is an inner membrane protein that plays a crucial role in the export of the polysaccharide capsule to the cell surface . CtrB belongs to the polysaccharide co-polymerase (PCP) family of proteins .

CtrB's Functional Interactions

The export of capsular polysaccharide in N. meningitidis involves an ABC transporter (composed of CtrC and CtrD) and two additional proteins, CtrA and CtrB, that are proposed to form a cell envelope-spanning export complex . CtrA is an outer membrane protein, and CtrB is an inner membrane protein . CtrA and CtrB interact with their cognate partners to export polysaccharide, further supporting the model of an ABC transporter-PCP-OPX multiprotein complex that functions to export CPS across the cell envelope .

CtrB in Serogroup A Neisseria meningitidis

The nucleotide sequences of four biosynthetic genes (csaA-csaD) in serogroup A meningococci are unique, as is the biosynthesis cassette encoding csxAcsxC in serogroup X .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctrB; NMA0197; Capsule polysaccharide export inner-membrane protein CtrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
ctrB
Target Protein Sequence
MSEQLPVAVATETKAERKKPKKKSWIKKLSPLFWVTVIIPTVISLVYFGFFASDRFTSQS SFVVRSPKSQSSLNGLGAILQGTGFARAQDDIYTVQEYMQSRSALDALRKKMPIRDFYEK EGDIFSRFNGFGLRGEDEAFYQYYRDKVSIHFDSVSGISNLSVTSFNAGESQKINDALLK QGEVLINQLNERARQDTIRYAQEVVNSAEEQVKEASVQLTKFRVSNGIFDLKAQSDVQMG LVSKLQDELIVIQTQLDQVKAVTPENPQIPGLIAREKSLRKEISQQMKAISGGGEGSLSN QAAEYQRVYLENELAEKQLAAAMTSLESAKAEADRQQLYLEVISQPNKPDLAYEPNRLYN IVATFVIGLIVYGIVVLLSASIREHKN
Uniprot No.

Target Background

Function
This protein may function as part of an ATP-driven capsule polysaccharide export apparatus, in conjunction with CtrC and CtrD proteins.
Database Links

KEGG: nma:NMA0197

Protein Families
BexC/CtrB/KpsE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of CtrB in Neisseria meningitidis capsule formation?

CtrB functions as an essential component of the capsular polysaccharide export system in N. meningitidis. As an inner-membrane protein, it participates in the transport of capsular polysaccharides from the cytoplasm across the inner membrane, which is a critical step in the assembly of the bacterial capsule. The capsule transport system in N. meningitidis involves multiple proteins that work in concert to export newly synthesized capsular polysaccharides to the cell surface . The process begins with synthesis in the cytoplasm, followed by export through the inner membrane (where CtrB functions), transport across the periplasmic space, and final translocation through the outer membrane.

What regulatory mechanisms control CtrB expression during infection?

During infection, N. meningitidis encounters multiple environments within the host, necessitating rapid adaptation for survival . The expression of capsule-related genes, including CtrB, is highly regulated in response to environmental cues encountered during pathogenesis. Transcriptome analysis of N. meningitidis in human whole blood reveals significant up-regulation of genes involved in iron uptake systems under the control of the Fur regulator . Since capsule expression is critical for survival in blood, it is likely that CtrB and other capsule transport genes are regulated in coordination with these systems. Two-component regulatory systems, such as the PhoQ/PhoP system identified in transcriptome studies, may also influence CtrB expression during infection .

What experimental approaches are most effective for studying the structure-function relationship of recombinant CtrB?

For structural studies of recombinant CtrB, a combination of X-ray crystallography and cryo-electron microscopy provides comprehensive insights into protein structure. Researchers should consider:

  • Expression optimization: Similar to approaches used for TbpA and TbpB, cloning CtrB into expression vectors with appropriate tags for purification is essential . The method described for TbpA/B can be adapted—designing primers with appropriate restriction sites (such as NdeI and BamHI) for precise insertion into expression vectors.

  • Protein purification: Affinity chromatography followed by size-exclusion chromatography typically yields high-purity protein suitable for structural studies . If CtrB retains specific binding properties, these can be exploited for purification, similar to how recombinant TbpA and TbpB retained transferrin-binding ability.

  • Functional assays: In vitro reconstitution experiments using proteoliposomes can assess CtrB's transport activity. Site-directed mutagenesis targeting conserved residues helps identify critical functional domains within the protein structure.

How does capsule switching affect CtrB function in different N. meningitidis serogroups?

Capsule switching in N. meningitidis occurs through allelic exchange of capsule biosynthesis genes, primarily through transformation and horizontal DNA exchange . While the genetic mechanism of switching between serogroups B and C involves exchange of the polysialyltransferase gene, the impact on capsule transport proteins like CtrB requires further investigation.

Researchers have observed that capsule switching allows meningococcal clones to express different capsular polysaccharides while maintaining otherwise identical genetic profiles . This suggests that CtrB must maintain functional flexibility to accommodate different polysaccharide structures. Comparative analysis of CtrB sequences and structures across serogroups may reveal adaptive modifications that facilitate transport of different capsular components.

SerogroupCapsule CompositionPotential Impact on CtrB Function
ANon-sialic acid polysaccharideMay require unique transport mechanisms
B(α2→8)-linked polysialic acidOptimized for linear polysialic acid transport
C(α2→9)-linked polysialic acidAccommodates different linkage orientation
Y, W-135Sialic acid-containingHandles more complex polysaccharide structures

What are the challenges in expressing and purifying functional recombinant CtrB?

Expressing and purifying functional membrane proteins like CtrB presents several challenges:

  • Protein toxicity: Overexpression of membrane proteins often leads to toxicity in host cells. Using tightly regulated expression systems with inducible promoters can mitigate this issue.

  • Proper membrane insertion: CtrB must insert correctly into membranes to maintain its native conformation. Expression systems that facilitate proper membrane targeting, such as those using signal sequences recognized by E. coli, can improve yield of functional protein .

  • Solubilization and stability: Extracting membrane proteins requires careful selection of detergents that maintain protein stability while efficiently solubilizing the membrane. A detergent screening approach is often necessary to identify optimal conditions.

  • Maintaining quaternary structure: If CtrB functions as part of a complex, preserving protein-protein interactions during purification may be crucial for functional studies. Techniques such as co-expression with partner proteins or mild solubilization conditions can help maintain these interactions.

What genetic approaches can be used to study the role of CtrB in capsule biosynthesis?

Several genetic approaches have proven effective for studying membrane proteins involved in virulence factor transport:

  • Gene knockout and complementation: Creating CtrB deletion mutants followed by complementation with wild-type or mutated genes can establish the protein's essential functions. Similar approaches have been successfully applied to study TbpA and TbpB, revealing their roles in protection against meningococcal challenge .

  • Site-directed mutagenesis: Systematic mutation of conserved residues can identify amino acids critical for CtrB function. This approach should target predicted transmembrane domains, cytoplasmic loops, and potential interaction sites with other capsule transport proteins.

  • Reporter gene fusions: Fusing CtrB to reporter proteins can help track its expression, localization, and topology within the membrane. Careful design is needed to ensure the fusion doesn't disrupt normal protein function.

  • Conditional expression systems: For essential genes, conditional expression allows controlled depletion of the protein to study phenotypic consequences without completely eliminating viability.

How can molecular detection methods be adapted to study CtrB expression across different serogroups?

Researchers can adapt molecular detection methods similar to those developed for serogroup identification to study CtrB expression:

  • Loop-mediated isothermal amplification (LAMP): The LAMP assay developed for serogroup identification achieves high sensitivity (detecting down to 10 copies) and specificity . This technique could be modified to target CtrB gene variants across serogroups, allowing rapid identification of expression patterns.

  • Primer design considerations: Similar to the serogroup-specific LAMP assay, primers must be designed to account for sequence variations between strains. The ARMS principle used to differentiate between similar sequences in serogroups Y and W could be applied to detect subtle variations in CtrB genes .

  • Multiplex detection systems: Simultaneous detection of multiple CtrB variants could be developed using multiplexed assays, similar to how multiple serogroups can be identified in a single reaction.

  • Validation against reference strains: Any new detection system should be validated using well-characterized reference strains representing different serogroups, as was done with the serogroup-specific LAMP assay (which was tested against 15 N. meningitidis strains and 19 non-N. meningitidis species) .

What transcriptomic approaches would reveal CtrB regulation during infection?

Transcriptome analysis provides valuable insights into gene regulation during infection:

  • Ex vivo infection models: Using human whole blood as an ex vivo infection model allows for time-course transcriptome analysis under physiologically relevant conditions . This approach has revealed that N. meningitidis alters expression of approximately 30% of its genome during blood infection, with significant changes in transport proteins and virulence factors.

  • RNA sequencing (RNA-Seq): High-throughput sequencing of RNA provides comprehensive coverage of the transcriptome, allowing identification of differential expression patterns and potential regulatory elements affecting CtrB expression.

  • Quantitative PCR validation: Key findings from transcriptome studies should be validated using qPCR to confirm expression patterns of CtrB and related genes under various conditions.

  • Integrative analysis: Combining transcriptomic data with proteomic studies and functional assays can provide a more complete understanding of how CtrB expression correlates with protein levels and functional outcomes during infection.

How does CtrB contribute to N. meningitidis survival in human blood?

The capsule is essential for meningococcal survival in human blood, protecting against complement-mediated killing and phagocytosis. As a critical component of the capsule export system, CtrB plays an indirect but vital role in this protection .

Transcriptome analysis of N. meningitidis during blood infection reveals up-regulation of multiple systems involved in adaptation to this environment . Although CtrB wasn't specifically mentioned in the search results, we can infer that capsule transport proteins would be coordinated with other virulence factors. The up-regulation of iron uptake systems and transcriptional regulators suggests a complex adaptive response in which capsule expression—and consequently CtrB function—would be integrated.

The PhoQ/PhoP two-component system, which was up-regulated during blood infection, has been shown to modulate meningococcal virulence factors including lipopolysaccharide . This regulatory system may also influence capsule expression and transport, potentially affecting CtrB activity during bloodstream invasion.

What is the potential impact of CtrB mutations on meningococcal virulence?

Mutations affecting CtrB function could have significant consequences for meningococcal virulence:

  • Capsule deficiency: Disruption of CtrB function would impair capsule transport, potentially leading to reduced capsule expression or altered capsule structure. Since the capsule is a major virulence factor, such mutations would likely attenuate virulence.

  • Serogroup-specific effects: The impact of CtrB mutations might vary depending on the serogroup, as different capsular polysaccharides may have different requirements for transport. This could explain some of the variation in virulence between serogroups.

  • Fitness cost vs. virulence: Some mutations might enhance capsule production but impose a fitness cost in certain environments, creating a balance between virulence and adaptability.

  • Compensatory mechanisms: The complexity of capsule biosynthesis and transport systems suggests that compensatory mechanisms might exist to overcome certain deficiencies in CtrB function.

How can recombinant CtrB be evaluated as a potential vaccine antigen?

Evaluation of CtrB as a vaccine antigen would follow similar approaches to those used for other meningococcal proteins:

  • Animal models: Like the mouse intraperitoneal-infection model used to evaluate TbpA and TbpB, similar models could assess protection conferred by CtrB immunization . TbpA was found to afford protection against meningococcal challenge when administered as the sole immunogen, suggesting membrane proteins can be effective vaccine antigens.

  • Cross-reactivity assessment: A key consideration is whether antibodies against CtrB from one serogroup would protect against other serogroups. TbpA provided protection extending to multiple serogroups, whereas TbpB protection was more limited . Similar comparative studies would be essential for CtrB.

  • Bactericidal activity: Serum bactericidal assays would determine whether anti-CtrB antibodies can mediate complement-dependent killing of meningococci. This is critical since bactericidal activity correlates with protection against meningococcal disease.

  • Epitope mapping: Identifying protective epitopes within CtrB would guide vaccine design, potentially focusing on conserved regions that elicit cross-protective responses.

What considerations are important when designing CtrB-based vaccine components?

Several key considerations should guide development of CtrB-based vaccine components:

  • Protein conformation: Since antibody recognition of membrane proteins is often conformation-dependent, maintaining native protein structure is crucial . This may require specialized formulation approaches to stabilize the protein.

  • Adjuvant selection: The choice of adjuvant can significantly impact immunogenicity and the quality of immune responses against membrane proteins.

  • Capsule switching concerns: The phenomenon of capsule switching observed in N. meningitidis has implications for vaccine design . Targeting conserved proteins like CtrB might provide broader protection than capsule-based vaccines alone, especially considering that meningococcal clones can switch capsule types and potentially escape capsule-directed immunity.

  • Combination approaches: Combining CtrB with other vaccine antigens may provide more comprehensive protection. For example, a vaccine incorporating both CtrB and TbpA might target different aspects of meningococcal virulence.

  • Impact of genetic diversity: The genetic diversity of CtrB across meningococcal strains must be assessed to ensure broad coverage. This is particularly important given the evidence for horizontal gene transfer and recombination in N. meningitidis .

Vaccine ApproachAdvantagesChallengesEvidence Base
CtrB aloneTargets essential function, potentially broad coverageMay have limited immunogenicity as membrane proteinSimilar to TbpA approach
CtrB + capsular polysaccharideCombines protein and polysaccharide targetsProduction complexity, capsule switching concernsSupported by findings on capsule switching
Multi-protein approach (CtrB + other membrane proteins)Targets multiple virulence mechanismsComplex formulation and productionBased on TbpA/TbpB studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.