Recombinant Neisseria meningitidis serogroup A / serotype 4A Capsule polysaccharide export inner-membrane protein CtrC (ctrC)

Shipped with Ice Packs
In Stock

Description

Comparative Analysis of CtrC Variants

CtrC proteins from different N. meningitidis serogroups share significant homology but exhibit distinct amino acid variations that may influence their specific functions in different strains. Table 1 presents a comparison between serogroup A and B CtrC proteins.

Table 1: Comparison of CtrC Properties Between N. meningitidis Serogroups

PropertySerogroup A CtrCSerogroup B CtrC
UniProt IDP57012P32015
Source strainZ2491MC58
Length (amino acids)265265
Expression region1-2651-265
TagN-terminal HisN-terminal His

While both proteins share the same length of 265 amino acids, sequence variations exist that may influence their specific interactions with other components of the capsule export machinery .

Expression and Purification Systems

Recombinant CtrC from N. meningitidis serogroup A is typically expressed in Escherichia coli expression systems . The manufacturing process involves cloning the ctrC gene from strain Z2491 into appropriate expression vectors, followed by transformation into E. coli host cells for protein production.

The resulting recombinant protein includes an N-terminal His-tag that facilitates purification using affinity chromatography techniques . This approach yields high-purity protein suitable for research applications. The expressed protein maintains its structural integrity and functional properties, making it valuable for studies investigating meningococcal pathogenesis and vaccine development .

Functional Role in Capsular Polysaccharide Export

CtrC plays a crucial role in the export of capsular polysaccharides to the surface of N. meningitidis, which is essential for bacterial virulence and pathogenesis . The protein functions as part of an ABC (ATP-binding cassette) transporter complex that includes CtrD and interacts with CtrA and CtrB to form a cell envelope-spanning export machinery .

The ABC Transporter Complex

In N. meningitidis, export of polysaccharides (including PSA in serogroup A) to the surface of the bacterium requires two proteins that form an ABC transporter (CtrC and CtrD) and two additional proteins, CtrA and CtrB . CtrC serves as the transmembrane component of this transporter, facilitating the movement of capsular polysaccharides across the inner membrane .

This complex transport system can be visualized as follows:

  1. CtrC and CtrD form the ABC transporter in the inner membrane

  2. CtrB (a polysaccharide co-polymerase family protein) extends ~125 Å from the inner membrane into the periplasm

  3. CtrA (an outer membrane polysaccharide export protein) forms a pore in the outer membrane

  4. Together, these proteins create a continuous channel for capsular polysaccharide export

Cryo-EM studies have revealed that CtrB forms a conical oligomer that extends from the membrane, consistent with its proposed role in the envelope-spanning export complex . Cross-complementation studies have shown that PCP-OPX pairs (like CtrB-CtrA) require interactions with their cognate partners to export polysaccharide, supporting the model of an ABC transporter-PCP-OPX multiprotein complex .

Relevance to Meningococcal Pathogenesis and Vaccine Development

The capsular polysaccharide of N. meningitidis is a major virulence determinant that protects the bacterium from host immune defenses . Understanding the proteins involved in capsule biosynthesis and export, including CtrC, is critical for developing strategies to combat meningococcal disease.

Serogroup A N. meningitidis, which expresses the CtrC protein studied here, is responsible for a significant burden of meningococcal disease, particularly in the "meningitis belt" of sub-Saharan Africa . The capsular genes, including ctrC, are located within the IHT-A1 locus, which contains genes for capsule biosynthesis and transport .

Capsular Switching and Genetic Diversity

Studies have demonstrated that capsular switching can occur between different N. meningitidis serogroups, such as between serogroups A and C . This process involves the horizontal transfer of capsular genes, potentially including ctrC, and can lead to the emergence of new pathogenic strains . Understanding the genetic basis of capsular switching is important for tracking the evolution of meningococcal strains and predicting potential outbreaks.

Molecular typing of invasive N. meningitidis isolates often includes analysis of the capsular transport genes, including ctrA, which is functionally related to ctrC . The ctrA gene is commonly used in real-time PCR assays for the detection and characterization of meningococcal isolates .

Research Applications

Recombinant CtrC protein has several important research applications:

Functional Studies

The recombinant protein enables in-depth studies of the mechanisms of capsular polysaccharide export in N. meningitidis . Biochemical and structural analyses using the purified protein can elucidate the interactions between CtrC and other components of the export machinery, potentially identifying targets for therapeutic intervention.

Immunological Research

Currently, vaccines against meningococcal serogroup B include components like factor H binding protein (fHBP), Neisserial adhesin A (NadA), and Neisserial heparin binding antigen (NHBA) . These vaccines have shown efficacy against diverse strains, but continued research into capsule export mechanisms, including the role of CtrC, may identify additional targets for future vaccine development.

Diagnostic Development

Knowledge of capsule export proteins, including CtrC, contributes to the development of improved diagnostic methods for meningococcal disease . Molecular detection methods targeting genes involved in capsule biosynthesis and export can provide rapid and specific identification of N. meningitidis serogroups.

Comparison with CtrC from Other Neisseria Species and Strains

The CtrC protein from N. meningitidis serogroup A / serotype 4A shares structural and functional similarities with CtrC proteins from other meningococcal serogroups but exhibits distinct sequence variations that may influence its specific interactions and functions .

Sequence Homology

For example, while serogroup A produces a capsule composed of N-acetyl-D-mannosamine-1-phosphate, serogroup B produces a capsule composed of α2,8-linked polysialic acid . These different capsular compositions may require subtle variations in the export machinery, including CtrC.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify it in your order for preferential development.
Synonyms
ctrC; NMA0196; Capsule polysaccharide export inner-membrane protein CtrC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
ctrC
Target Protein Sequence
MKELHKTSFLESLLIQKRVIGALLMREIITRYGRNNIGFLWLFVEPLLLTLVMVLMWKFF RMHNVSALNIVAFTLTGYPMMMMWRNASNHAIGSISANTSLLYHRNVRVLDTIFARMLLE IAGATIAQVVIMFALVIIGWIDVPADIFYMLLAWLLMAMFAVGLGLVICSVAFHFEPFGK VWSTISFVMMPLSGVFFFVHNLPQQLQHYVLMIPMVHGTEMFRAGYFGDSVTTYENPWYI LLCNLVLLLLGLAVVARFSKGVEPQ
Uniprot No.

Target Background

Function
CtrC is involved in forming an ATP-driven capsule polysaccharide export apparatus, in conjunction with CtrB and CtrD proteins.
Database Links

KEGG: nma:NMA0196

Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CtrC in meningococcal capsule biosynthesis?

CtrC functions as part of an ATP-driven capsule polysaccharide export apparatus in association with CtrB and CtrD proteins . This multiprotein complex plays a critical role in transporting capsular polysaccharides across the inner membrane to the bacterial cell surface. The capsule is a prerequisite for meningococcal virulence, providing protection against host immune defenses and environmental stresses . As an integral membrane component of this machinery, CtrC likely forms a channel through which capsular polysaccharides are translocated during the export process, with ATP hydrolysis by CtrD providing the energy for this transport.

How does CtrC contribute to meningococcal pathogenesis?

The capsule is essential for N. meningitidis virulence, serving as a critical virulence factor that protects the bacterium from complement-mediated killing and phagocytosis . By facilitating capsule export, CtrC directly contributes to the pathogenic potential of meningococci. Clinical research has demonstrated that encapsulated (serogroupable) strains are typically associated with invasive meningococcal disease, while unencapsulated strains often exist as commensals . Disruption of CtrC function would likely impair capsule formation, resulting in attenuated virulence and increased susceptibility to host immune clearance.

What expression systems are optimal for recombinant CtrC production?

Recombinant CtrC protein has been successfully expressed in E. coli systems with N-terminal His-tags to facilitate purification . For optimal expression of this membrane protein, researchers should consider:

  • Lower induction temperatures (16-25°C) to minimize inclusion body formation

  • Moderate inducer concentrations to prevent toxicity

  • Specialized E. coli strains designed for membrane protein expression

  • Expression constructs containing the full-length sequence (amino acids 1-265)

The purified protein typically achieves >90% purity as determined by SDS-PAGE and can be stored as a lyophilized powder or in buffer containing glycerol to maintain stability.

What are the recommended storage and handling protocols for recombinant CtrC?

Based on multiple commercial protein preparations, the following protocols are recommended for optimal handling of recombinant CtrC :

ParameterRecommendation
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0) or Tris-based buffer with 50% glycerol
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Long-term Storage-20°C to -80°C with 5-50% glycerol
Working AliquotsStore at 4°C for up to one week
Important NotesAvoid repeated freeze-thaw cycles; centrifuge vials briefly before opening

Proper handling is essential as membrane proteins are particularly susceptible to denaturation and aggregation .

What assays can effectively measure CtrC function in capsule export?

While the search results don't detail specific assays for CtrC function, several approaches can be developed based on its role in capsule export:

  • Capsule detection assays: Using serogroup-specific antibodies with techniques like slide agglutination, ELISA, or flow cytometry to quantify surface capsular polysaccharides.

  • Genetic complementation studies: Restoring capsule formation in CtrC-deficient strains through plasmid-based expression of wild-type or mutant variants.

  • Membrane localization analysis: Using subcellular fractionation and immunoblotting to verify proper membrane integration.

  • Protein-protein interaction assays: Co-immunoprecipitation or bacterial two-hybrid systems to confirm interactions with CtrA, CtrB, and CtrD components .

  • ATP hydrolysis measurements: Quantifying energy consumption by the export apparatus in membrane vesicle preparations.

  • Serum resistance testing: Evaluating bacterial survival in human serum as a functional measure of capsule integrity.

How do CtrC sequence variations between serogroups impact function?

Sequence analysis reveals notable differences between CtrC proteins from serogroups A and B . These variations likely reflect adaptation to the distinct chemical structures of capsular polysaccharides produced by each serogroup. Serogroup A produces a homopolymer of N-acetyl-mannosamine-phosphate, while serogroup B synthesizes α2,8-linked polysialic acid .

Key areas of sequence divergence include:

  • The N-terminal region (positions 2-9)

  • Central hydrophobic domains (positions 50-150)

  • C-terminal region that may interact with other export components

These differences may influence substrate specificity, protein-protein interactions within the export machinery, and the efficiency of capsule translocation. Experimental approaches utilizing chimeric proteins or site-directed mutagenesis could help determine which regions are responsible for serogroup-specific functions.

What is known about protein-protein interactions involving CtrC?

Protein interaction studies indicate that CtrC participates in a network of functionally associated proteins involved in capsule production and export . High-confidence interactions include:

Interacting ProteinFunctionInteraction Score
CtrBCapsule polysaccharide export inner-membrane protein0.997
CtrDCapsule polysaccharide export ATP-binding protein0.996
CtrACapsule polysaccharide export outer membrane protein0.997
LipACapsule polysaccharide modification protein0.944

CtrC forms a complex with these proteins to create a functional export apparatus spanning the cell envelope. The interaction with CtrD, an ATP-binding protein, supports the energy-dependent nature of the export process. Additional interactions with lower confidence scores suggest coordination between capsule export and other cellular processes, including pilin glycosylation and outer membrane organization .

What role does CtrC play in capsular switching between meningococcal serogroups?

Capsular switching, the phenomenon where a strain changes its capsular serotype through genetic recombination, has significant epidemiological implications. Research has identified cases where strains belonging to sequence type 7 (ST-7) underwent switching from serogroup A to serogroup C . While the specific role of CtrC in this process isn't explicitly detailed in the literature, as a component of the export machinery, its adaptability to different capsular types would be essential for successful switching.

Comparative genomic analysis of the capsular gene clusters from strains that have undergone switching could reveal whether modifications in CtrC are required to accommodate the new capsular type. Understanding this process has important implications for tracking the emergence of new pathogenic variants and for vaccine development strategies .

What are the key challenges in developing in vitro systems to study CtrC function?

Several technical challenges complicate the study of CtrC-mediated capsule export:

  • As an integral membrane protein, maintaining CtrC's native structure and function during purification requires careful detergent selection and handling.

  • The functional unit involves multiple proteins (CtrA, CtrB, CtrC, CtrD), making it difficult to isolate CtrC's specific contribution.

  • Reconstituting the export process in vitro requires establishing the correct membrane environment and energy supply.

  • Detecting and quantifying exported capsular polysaccharides, which have complex structures that vary between serogroups, presents analytical challenges.

Future approaches might include developing liposome-reconstituted systems containing the entire export apparatus, creating reporter systems for capsule export, or using in situ labeling techniques to track the movement of capsular components.

How might CtrC be targeted for therapeutic development?

Given its essential role in capsule formation, CtrC represents a potential target for novel antimicrobial strategies. Several approaches could be explored:

  • Small molecule inhibitors that disrupt CtrC function or its interactions with other export components could prevent capsule formation, rendering bacteria susceptible to immune clearance.

  • Peptide-based inhibitors designed to mimic interaction interfaces between CtrC and its binding partners.

  • Antibody-based approaches targeting accessible regions of the export machinery.

  • CRISPR-based antimicrobials targeting the ctrC gene.

The development of such approaches requires detailed structural understanding of CtrC and its interactions, as well as consideration of potential cross-reactivity with host proteins. Current meningococcal vaccines primarily target capsular polysaccharides themselves , but targeting the export machinery could provide complementary strategies, particularly for serogroup B where capsule-based vaccines face challenges due to molecular mimicry with human neural cell adhesion molecules.

How can researchers effectively analyze CtrC expression in clinical isolates?

Analyzing CtrC expression in clinical isolates presents several methodological challenges:

  • Primer/probe design for qPCR: Must account for sequence variations between serogroups while targeting conserved regions.

  • Protein detection: Generating antibodies specific to CtrC that work across serogroups requires careful epitope selection.

  • Normalization strategies: Identifying appropriate reference genes or proteins that maintain stable expression across diverse clinical isolates.

  • Sample preparation: Standardizing membrane fraction isolation from clinical samples to ensure comparable results.

  • Correlation with phenotype: Linking CtrC expression levels to clinically relevant outcomes such as serum resistance or invasive potential.

Combining genomic, transcriptomic, and proteomic approaches provides the most comprehensive analysis, allowing researchers to examine sequence variations, expression levels, and potential post-translational modifications simultaneously .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.