Recombinant Neisseria meningitidis serogroup A / serotype 4A Glycerol-3-phosphate acyltransferase (plsY)

What is the functional role of Glycerol-3-phosphate acyltransferase (PlsY) in Neisseria meningitidis?

Glycerol-3-phosphate acyltransferase (PlsY) in Neisseria meningitidis functions as a critical enzyme in phospholipid biosynthesis, catalyzing the acylation of glycerol-3-phosphate at the sn-1 position. This represents the first committed step in the biosynthesis of membrane phospholipids, which are essential components of bacterial cell membranes. The enzyme transfers an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA) . As a membrane-embedded protein with multiple transmembrane domains, PlsY plays a crucial role in maintaining membrane integrity and function in N. meningitidis, potentially influencing both commensal and virulent behaviors of the bacterium . The enzyme's activity directly impacts membrane composition, which in turn affects membrane fluidity, permeability, and the bacterium's ability to adapt to different environmental conditions.

What are the optimal storage and handling conditions for recombinant PlsY protein?

For optimal preservation of recombinant N. meningitidis PlsY protein activity, storage at -20°C is recommended for routine use, while extended storage should be at -20°C or -80°C. The protein is typically maintained in a Tris-based buffer containing 50% glycerol that has been optimized specifically for PlsY stability . To prevent protein degradation and activity loss, it is critical to avoid repeated freeze-thaw cycles. Instead, prepare working aliquots that can be stored at 4°C for up to one week . When handling the protein, maintain sterile techniques and use appropriate personal protective equipment. For experimental work requiring longer active periods, consider preparing fresh aliquots from frozen stocks rather than extending the 4°C storage period beyond the recommended one-week timeframe.

How is the plsY gene (NMA1261) organized in Neisseria meningitidis serogroup A / serotype 4A?

The plsY gene in N. meningitidis serogroup A / serotype 4A (strain Z2491) is designated as locus NMA1261 in the genome . This gene encodes a protein of 200 amino acids with a molecular weight of approximately 22 kDa. The amino acid sequence (MFNIPAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGATNVLRSGKKKAAALTLLGDAAKGLVAVLLARVLQEPLGLSDSAIAAVALAALVGHMWPVFFGFKGGKGVATALGVLLALSPTTALVCALIWLVMAFGFKVSSLAALTATIAAPLAALFFMPHTSWIFATLAIAILVLLRHKSNILNLIKGKESKIGEKR) reveals a hydrophobic protein with multiple transmembrane domains, consistent with its role as a membrane-embedded enzyme . Analysis of the sequence suggests that PlsY contains conserved catalytic residues essential for acyltransferase activity. The gene exists within the context of the highly structured N. meningitidis genome, which is organized into phylogenetic clades that have acquired and remodeled specific genomic tracts through evolution .

What methods can be used to evaluate the genetic diversity of plsY across different strains of N. meningitidis?

To evaluate the genetic diversity of plsY across different N. meningitidis strains, researchers can employ several molecular techniques:

• PCR amplification followed by restriction fragment length polymorphism (RFLP) analysis, similar to methods used for the penA gene characterization. This technique involves digesting PCR products with specific restriction enzymes like TaqI and analyzing the resulting fragments via gel electrophoresis .

• Whole genome sequencing (WGS) combined with bioinformatic analysis to identify allelic variants of plsY across different strains and correlate these with phylogenetic clades .

• Multilocus restriction typing (MLRT) to categorize strains into different restriction types (RTs) that can serve as predictors for multilocus sequence typing (MLST) clonal complexes .

• Multiple sequence alignment using tools like MAFFT in Jalview to identify sequence differences between strains and potential functional mutations .

• BLASTn searches against the NCBI database to detect homology between plsY alleles and corresponding genes in other Neisseria species, which can reveal horizontal gene transfer events .

These methods collectively enable comprehensive characterization of plsY genetic diversity and its relationship to N. meningitidis population structure.

How does recombinant PlsY protein expression compare with native expression in N. meningitidis?

Recombinant PlsY protein expression systems offer controlled production of the enzyme but may differ from native expression in N. meningitidis in several important ways. In native contexts, PlsY expression is regulated by environmental cues and metabolic needs of the bacterium, whereas recombinant systems typically employ constitutive or inducible promoters that may not replicate natural expression dynamics. Recombinant PlsY often includes tags for purification and detection purposes, which can potentially affect protein folding, activity, or interaction capabilities .

The lipid environment also differs significantly between recombinant expression systems and the native N. meningitidis membrane, which may impact proper folding and function of this membrane-embedded enzyme. Additionally, post-translational modifications that might occur in N. meningitidis may be absent or different in recombinant expression systems. When utilizing recombinant PlsY for functional studies, researchers should account for these potential differences by validating enzyme activity and implementing experimental controls that address the limitations of recombinant expression.

How might PlsY contribute to the pathogenicity of Neisseria meningitidis?

PlsY likely contributes to N. meningitidis pathogenicity through multiple mechanisms related to membrane phospholipid biosynthesis and bacterial adaptation. As the first enzyme in phospholipid biosynthesis, PlsY activity directly influences membrane composition, which affects the bacterium's ability to respond to environmental stresses encountered during infection . The membrane composition impacts key virulence processes including adhesion to host cells, resistance to antimicrobial peptides, and formation of outer membrane vesicles that can deliver virulence factors.

N. meningitidis pathogenicity appears to be multifactorial, developed through independent evolutionary events across different clones rather than through a single virulence determinant . The structured population of N. meningitidis into distinct phylogenetic clades suggests that each clade may have acquired and remodeled specific genomic regions, including those affecting membrane biosynthesis enzymes like PlsY, potentially impacting virulence behavior .

Interestingly, despite high rates of recombination in N. meningitidis, distinct lineages persist over time and disseminate globally, suggesting that specific genetic configurations, potentially including particular plsY variants, may confer selective advantages during host colonization or infection . Further research using recombinant PlsY in functional studies could help elucidate its specific contributions to the commensal-pathogenic transition in N. meningitidis.

What experimental approaches can determine the impact of PlsY activity on complement evasion by N. meningitidis?

Investigating the relationship between PlsY activity and complement evasion requires sophisticated experimental approaches:

• Isogenic mutant comparison studies: Generate N. meningitidis strains with modified plsY genes (knockout, overexpression, or point mutations) and compare their susceptibility to complement-mediated killing using serum bactericidal assays.

• Membrane composition analysis: Use lipidomics to characterize how PlsY variants affect phospholipid composition, particularly focusing on how these changes might impact the incorporation of factor H binding protein (fHbp) into the membrane .

• Protein interaction assays: Employ co-immunoprecipitation or surface plasmon resonance to investigate whether membrane alterations caused by PlsY affect the binding of complement factor H (CFH) to fHbp on the bacterial surface .

• Structure-function studies: Use site-directed mutagenesis of recombinant PlsY to identify specific residues that affect enzyme activity, then correlate these with changes in membrane properties and complement resistance.

• In vivo virulence models: Compare the virulence of wild-type and plsY-modified strains in animal models with intact or manipulated complement systems to assess the contribution of PlsY to immune evasion and pathogenesis.

These approaches could reveal whether PlsY-mediated changes in membrane composition affect the bacteria's ability to recruit CFH to its surface via fHbp, which is a critical mechanism for complement evasion by N. meningitidis .

How can recombinant PlsY be used to study the evolution of membrane biosynthesis pathways across Neisseria phylogenetic clades?

Recombinant PlsY can serve as a powerful tool for studying evolutionary aspects of membrane biosynthesis across Neisseria phylogenetic clades:

• Comparative enzymology: Express and purify recombinant PlsY variants from different N. meningitidis clades to compare their kinetic parameters, substrate specificities, and responses to environmental conditions. This can reveal functional adaptations specific to each clade.

• Complementation experiments: Use recombinant PlsY from various clades to complement plsY deficiencies in laboratory strains, assessing whether clade-specific variants confer distinct phenotypes related to membrane composition and function.

• Structural biology approaches: Determine crystal structures of PlsY variants from different clades to identify structural differences that might explain functional divergence or adaptation to specific ecological niches.

• Horizontal gene transfer (HGT) analysis: Compare plsY sequences across Neisseria species to identify potential HGT events, similar to the acquisition of restriction modification systems observed in N. meningitidis . This can be accomplished through:

  Analysis Method	Application to PlsY	Expected Outcome
  Phylogenetic reconstruction	Compare plsY sequences from multiple Neisseria species	Identification of incongruence between gene and species trees indicating HGT
  Sequence similarity analysis	BLASTn searches for plsY homologs	Detection of unusually high similarity between distantly related species
  Codon usage analysis	Compare plsY codon usage patterns	Recognition of atypical codon usage indicating recent gene acquisition

• Experimental evolution: Subject N. meningitidis strains to various selective pressures and monitor changes in plsY sequence and expression over time, providing insights into real-time adaptation of membrane biosynthesis pathways.

This multifaceted approach can reveal how membrane biosynthesis pathways have evolved across the structured population of N. meningitidis, potentially contributing to the emergence and persistence of distinct lineages .

What methodologies are effective for studying PlsY interactions with other components of the phospholipid biosynthesis pathway?

Several complementary methodologies can effectively characterize PlsY interactions with other phospholipid biosynthesis pathway components:

• Bacterial two-hybrid systems: Adapt these systems to investigate protein-protein interactions between PlsY and other membrane-associated biosynthetic enzymes, overcoming limitations of traditional yeast two-hybrid assays for membrane proteins.

• In vitro reconstitution assays: Purify recombinant PlsY and potential interacting partners to reconstitute partial or complete phospholipid biosynthesis pathways in liposomes or nanodiscs, allowing for controlled biochemical analysis of sequential enzymatic activities.

• Crosslinking mass spectrometry (XL-MS): Apply chemical crosslinking followed by mass spectrometry to identify proteins in close proximity to PlsY in the native membrane environment, providing a snapshot of the enzyme's interaction network.

• FRET-based assays: Develop Förster resonance energy transfer assays using fluorescently labeled PlsY and partner proteins to detect and quantify interactions in real-time within membrane environments.

• Metabolic flux analysis: Use isotope-labeled precursors combined with liquid chromatography-mass spectrometry to track the flow of metabolites through the phospholipid biosynthesis pathway when PlsY variants are introduced.

• Co-evolution analysis: Apply computational approaches to identify proteins that have co-evolved with PlsY across Neisseria species, suggesting functional interactions maintained throughout evolution.

These methods can reveal how PlsY functions within the broader context of membrane biosynthesis and how these interactions might vary across different N. meningitidis clades or under different environmental conditions.

How do restriction modification systems influence the genetic diversity of plsY across N. meningitidis populations?

Restriction modification systems (RMSs) significantly impact the genetic diversity of plsY and other genes across N. meningitidis populations through several mechanisms:

The distribution of RMSs in different strains coincides with the phylogenetic clade structure of N. meningitidis, suggesting they generate a differential barrier to DNA exchange that maintains the observed population structure . Understanding this relationship provides insights into how plsY diversity is shaped by these mechanisms and contributes to the broader evolutionary framework for the population biology of N. meningitidis.

What are the key considerations for designing experiments to assess PlsY enzymatic activity?

Designing robust experiments to assess PlsY enzymatic activity requires careful consideration of several factors:

• Substrate preparation: The primary substrates for PlsY are glycerol-3-phosphate and acyl-phosphate. Both must be freshly prepared to prevent degradation, with acyl-phosphate being particularly unstable in aqueous solutions.

• Membrane environment reconstitution: As a membrane-embedded enzyme, PlsY requires an appropriate lipid environment for optimal activity. Consider using liposomes, nanodiscs, or detergent micelles that mimic the native membrane composition of N. meningitidis.

• Assay methods: Several approaches can be used to monitor PlsY activity:

  • Radiometric assays using 14C-labeled substrates

  • Coupled enzyme assays that link lysophosphatidic acid production to a spectrophotometrically detectable reaction

  • Mass spectrometry-based detection of reaction products

  • Fluorescence-based assays using modified substrates

• Controls and validation: Include enzyme-free negative controls and heat-inactivated enzyme controls. Validate assay conditions using commercially available lysophosphatidic acid standards.

• Environmental parameters: Systematically test the effects of pH, temperature, ionic strength, and divalent cation concentrations on enzyme activity to establish optimal conditions that reflect the physiological environment of N. meningitidis.

• Detergent considerations: If using detergent-solubilized PlsY, carefully select detergent types and concentrations that maintain enzyme structure without inhibiting activity, and be aware that different detergents may affect activity measurements.

• Data analysis: Apply appropriate enzyme kinetics models to determine parameters like Km, Vmax, and catalytic efficiency, which can be compared across different PlsY variants or experimental conditions.

How can researchers effectively compare PlsY from different Neisseria species and strains?

Effective comparison of PlsY across Neisseria species and strains requires a multifaceted approach:

• Sequence-based analysis:

  • Multiple sequence alignment to identify conserved catalytic residues and variable regions

  • Phylogenetic analysis to establish evolutionary relationships between PlsY variants

  • Prediction of structural differences based on sequence variation

• Structural comparisons:

  • Homology modeling based on crystal structures of related acyltransferases

  • If possible, experimental structure determination using X-ray crystallography or cryo-EM

  • Molecular dynamics simulations to predict functional implications of structural differences

• Functional characterization:

  • Standardized enzymatic assays under identical conditions to directly compare catalytic parameters

  • Substrate preference profiles to identify specialization for different acyl chain lengths or structures

  • Temperature and pH optima to reveal adaptation to different host environments

• Expression profiling:

  • Quantitative RT-PCR to compare native expression levels across species/strains

  • Promoter analysis to identify regulatory differences

  • Stress response studies to determine how expression changes under various conditions

• Comparative genomics context:

  • Analysis of genomic neighborhood to identify co-evolved genes

  • Identification of strain-specific or clade-specific genetic elements that might influence PlsY function

• Complementation studies:

  • Cross-species complementation experiments to test functional interchangeability

  • Generation of chimeric proteins to map species-specific functional domains

This comprehensive approach allows researchers to understand how PlsY has evolved across the Neisseria genus and how these differences might contribute to species- and strain-specific adaptations to different ecological niches and pathogenic potential.

What techniques can be used to investigate the role of PlsY in N. meningitidis membrane adaptation to host environments?

Investigating PlsY's role in membrane adaptation requires techniques spanning molecular genetics, biochemistry, and advanced imaging:

• Conditional expression systems: Develop strains with inducible plsY expression to study how controlled alteration of PlsY levels affects membrane composition and adaptation to host conditions.

• Site-directed mutagenesis: Create point mutations in catalytic or regulatory domains of PlsY to assess how specific residues contribute to enzyme function under different environmental conditions.

• Membrane fluidity analysis: Use fluorescence anisotropy, differential scanning calorimetry, or electron spin resonance to measure how PlsY activity affects membrane physical properties in response to temperature, pH, or other host-relevant stresses.

• Lipidomics profiling: Apply liquid chromatography-mass spectrometry to characterize comprehensive changes in membrane lipid composition when N. meningitidis is exposed to different host environments, correlating these with PlsY activity.

• Host cell interaction models: Develop in vitro models of host-pathogen interfaces, such as:

  • Nasopharyngeal epithelial cell co-culture systems

  • Blood-brain barrier models

  • Serum resistance assays

• In vivo imaging: Use fluorescently labeled lipid precursors combined with high-resolution microscopy to track membrane remodeling in real-time during host cell interaction.

• Transcriptional response analysis: Perform RNA-seq to identify genes co-regulated with plsY during host adaptation, revealing potential functional networks.

• Isotope labeling studies: Use deuterated or 13C-labeled precursors to track the incorporation of new phospholipids during adaptation to changing environments, providing insights into the dynamics of PlsY-mediated membrane remodeling.

These techniques can reveal how PlsY contributes to N. meningitidis' ability to adapt its membrane composition during the transition from commensal colonization to invasive disease, potentially informing new therapeutic approaches targeting this adaptation process.

How might PlsY be targeted for therapeutic development against N. meningitidis infections?

PlsY represents a promising therapeutic target against N. meningitidis infections for several reasons:

• Essential metabolic function: As a key enzyme in phospholipid biosynthesis, PlsY is likely essential for bacterial viability, making it an attractive target for antimicrobial development.

• Structural uniqueness: The acyltransferase mechanism of PlsY differs from mammalian counterparts, potentially allowing for selective targeting without significant host toxicity.

• Potential targeting strategies include:

  Approach	Methodology	Potential Advantage
  Small molecule inhibitors	Structure-based drug design targeting the acyl-phosphate binding site	High specificity for bacterial enzymes
  Substrate analogues	Development of non-hydrolyzable analogues of glycerol-3-phosphate	Competitive inhibition of enzymatic activity
  Allosteric modulators	Identification of regulatory sites that control PlsY activity	May be less susceptible to resistance development
  Membrane-disrupting peptides	Design of antimicrobial peptides that interact with PlsY-dependent membrane domains	Multiple mechanisms of action

• Resistance considerations: Given the essential nature of PlsY, resistance might develop through modifications that maintain function while reducing inhibitor binding. Monitoring natural variation in plsY across N. meningitidis strains could help predict potential resistance mechanisms.

• Combination approaches: PlsY inhibitors could be particularly effective when combined with other antimicrobials or with compounds that target complementary aspects of membrane function.

• Delivery strategies: Development of nanoparticle or liposomal delivery systems could enhance the targeting of PlsY inhibitors to N. meningitidis while minimizing off-target effects.

This therapeutic avenue represents a novel approach to addressing N. meningitidis infections, particularly in the context of increasing antibiotic resistance and the need for pathogen-specific treatments.

What role might PlsY play in the interaction between N. meningitidis and the human immune system?

PlsY likely influences N. meningitidis-immune system interactions through multiple mechanisms related to membrane composition and structure:

• Complement resistance: Membrane phospholipid composition affects the incorporation and presentation of factor H binding protein (fHbp), which recruits human complement factor H (CFH) to the bacterial surface, protecting against complement-mediated killing . PlsY activity may modulate this key immune evasion mechanism.

• Pattern recognition receptor activation: The acyl chain composition of membrane lipids, influenced by PlsY activity, can affect recognition by host pattern recognition receptors like Toll-like receptors, potentially modulating inflammatory responses.

• Outer membrane vesicle formation: PlsY-dependent changes in membrane curvature and phospholipid distribution may influence the formation and composition of outer membrane vesicles, which serve as delivery vehicles for immunomodulatory factors.

• Host cell adhesion and invasion: Membrane properties influence the presentation and function of adhesins and invasins, affecting the bacterium's ability to colonize mucosal surfaces and potentially cross the blood-brain barrier.

• Adaptation to immune pressures: Modification of membrane composition through altered PlsY activity could represent a mechanism for adapting to immune selection pressures, potentially explaining why distinct N. meningitidis lineages persist despite high recombination rates .

• Susceptibility to antimicrobial peptides: PlsY-mediated changes in membrane phospholipid composition could alter resistance to host-derived antimicrobial peptides that target bacterial membranes.

Understanding these interactions could explain the observed differences in virulence between N. meningitidis lineages and provide insights into why approximately 40% of the population carries N. meningitidis asymptomatically while others develop invasive disease .

How can multi-omics approaches advance our understanding of PlsY function in the context of N. meningitidis pathogenicity?

Integrated multi-omics approaches offer powerful frameworks for comprehensively understanding PlsY function in N. meningitidis pathogenicity:

• Genomics-proteomics integration: Correlate genetic variations in plsY across different N. meningitidis clades with proteomic analyses to identify how sequence variations translate to functional differences in protein expression, modification, and interaction networks.

• Transcriptomics-metabolomics coupling: Combine gene expression profiling with metabolite analysis to understand how regulation of plsY expression impacts downstream metabolic pathways, particularly under conditions mimicking different stages of infection.

• Lipidomics-phenomics correlation: Link comprehensive lipid profiling with high-throughput phenotypic assays to establish relationships between PlsY-dependent membrane composition changes and functional outcomes like serum resistance or adhesion capabilities.

• Systems biology modeling: Develop mathematical models integrating multi-omics data to predict how perturbations in PlsY function cascade through cellular networks, potentially identifying unexpected connections to virulence mechanisms.

• Spatial multi-omics: Apply emerging technologies that preserve spatial information when collecting omics data to understand how PlsY influences membrane domain organization and localized protein complex formation.

• Temporal multi-omics: Perform time-course experiments to capture dynamic changes in multiple molecular layers during host adaptation, revealing the temporal sequence of PlsY-dependent responses.

• Host-pathogen dual omics: Simultaneously analyze both bacterial and host cell responses during interaction experiments to understand the reciprocal relationship between PlsY-mediated membrane adaptations and host defense mechanisms.

These integrated approaches can reveal emergent properties not apparent from single-omics studies, potentially identifying new strategies for therapeutic intervention targeting PlsY-dependent processes in N. meningitidis pathogenicity.

What are the most significant unresolved questions regarding PlsY in N. meningitidis research?

Despite advances in understanding PlsY, several significant questions remain unresolved:

• Structure-function relationships: The detailed three-dimensional structure of N. meningitidis PlsY remains undetermined, limiting our understanding of its catalytic mechanism and potential for targeted inhibition.

• Regulatory networks: The factors controlling plsY expression during different phases of colonization and invasion are poorly characterized, including potential environmental sensors that might modulate PlsY activity.

• Evolutionary dynamics: While we know N. meningitidis maintains distinct phylogenetic clades despite high recombination rates , the specific role of plsY in this evolutionary framework remains unclear.

• Host-specific adaptation: How PlsY function might be optimized for the human host environment compared to other Neisseria species is not fully understood.

• Membrane microdomain organization: The potential role of PlsY in organizing functional membrane microdomains that may coordinate virulence factor presentation requires further investigation.

• Post-translational regulation: Potential post-translational modifications of PlsY that might fine-tune its activity in response to changing environments have not been thoroughly explored.

• Therapeutic potential: While PlsY represents a promising drug target, the feasibility of developing selective inhibitors and their efficacy in preventing or treating N. meningitidis infections remains to be established.