Recombinant Neisseria meningitidis serogroup A / serotype 4A Na (+)-translocating NADH-quinone reductase subunit C (nqrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nqrC; NMA0750; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
nqrC
Target Protein Sequence
MAKKFDKDSFSGTLIVVLAVSLICSVIVAGAVVGLKPIQEKQKLQDKQGYILSVAGLMDK DTDIGKTFAERIEQRVVDLATGEYVKDAPKDFSARIAGKDPAQSIRIKPEDDLAGIKSRA KYTEVYLVKGEDGKIGQIILPMHGNGLWSVMYGFVAIQPDGNTINGITYYEQGETPGLGG EIGNPLWQQKFVGKKLFDGQGKLALHVGKGAGSDKEHGVDALSGASLTSKGVQGSFAYWF GENGYIPYLNKLKSAGAQ
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE proteins are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links

KEGG: nma:NMA0750

Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Neisseria meningitidis nqrC and what is its biological significance?

Neisseria meningitidis nqrC is a subunit of the Na(+)-translocating NADH-quinone reductase complex, which plays a crucial role in the bacterial respiratory chain. This complex (Na(+)-NQR) functions as a primary sodium pump that converts the energy from NADH oxidation to create a sodium gradient across the bacterial membrane.

In N. meningitidis, a Gram-negative diplococcus that colonizes the human nasopharynx as both a commensal and potential pathogen, nqrC contributes to energy metabolism and adaptation to different host environments. The bacterium can cause life-threatening septicemia and meningitis in susceptible individuals, making understanding its metabolic systems essential for developing intervention strategies .

Methodologically, researchers studying nqrC should begin with phylogenetic analyses to understand its conservation across Neisseria species and other bacteria, followed by expression studies under varying environmental conditions that mimic the human host.

How does nqrC fit into the metabolic network of Neisseria meningitidis?

The nqrC protein functions within the central metabolic pathways of N. meningitidis, which have been characterized through flux balance analysis (FBA) and metabolic modeling. Research has established a genome-scale metabolic network comprising 1255 reactions encoded by 586 genes and 59 orphan genes .

Within this network, nqrC contributes to energy metabolism under varying oxygen conditions. N. meningitidis expresses a cbb3-type cytochrome oxidase as its only respiratory oxidase, allowing growth under microaerobic conditions. Under oxygen limitation, nitrite can replace oxygen as an alternative respiratory substrate through a truncated denitrification pathway .

To study nqrC's role in this network, researchers should:

  • Apply metabolic flux analysis using labeled substrates

  • Create knockout mutants to observe phenotypic changes

  • Measure growth rates under varying oxygen tensions and nutrient availability

  • Examine interactions with other respiratory components through protein-protein interaction studies

What is known about the genetic organization and expression of the nqrC gene in different meningococcal lineages?

The nqrC gene shows variable expression patterns across meningococcal lineages. Transcriptome analysis using differential RNA-seq (dRNA-seq) has mapped the transcriptional start sites (TSSs) for most protein-coding genes in N. meningitidis, revealing that many meningococcal genes lack classical σ70-type promoters .

Analysis of 29 meningococcal isolates through comparative genome hybridization and multilocus sequence typing has shown that about 40% of meningococcal core genes, including many metabolic genes, are affected by recombination . This has significant implications for the variability of nqrC across strains.

Researchers investigating nqrC expression should:

  • Use RT-qPCR to measure transcript levels under different conditions

  • Apply transcriptome sequencing to identify operon structures and regulatory elements

  • Analyze the 5' untranslated region for potential regulatory RNA structures

  • Consider strain-to-strain variations when interpreting expression data

What are the optimal expression systems for producing recombinant N. meningitidis nqrC?

Table 1: Comparison of Expression Systems for Meningococcal Recombinant Proteins

Expression SystemAdvantagesLimitationsSuitability for nqrC
E. coli pET vectorsHigh yield, well-established protocolsPotential improper folding of membrane proteinsGood for initial expression studies
E. coli pMTL vectorsUseful for toxic proteins, controlled expressionLower yields than pETRecommended for nqrC based on previous studies
Neisserial expression systemsNative post-translational modificationsTechnical challenges, lower yieldsBest for functional studies

When expressing nqrC, researchers should consider:

  • Codon optimization for the expression host

  • Inclusion of affinity tags that don't interfere with protein function

  • Expression conditions that facilitate proper membrane protein folding

  • Purification strategies that maintain protein stability and activity

Studies have successfully used pMTL vector series for expression of other Neisserial proteins, suggesting this approach may be suitable for nqrC as well .

How can researchers verify the functional integrity of recombinant nqrC protein?

Verifying functional integrity of recombinant nqrC requires multiple complementary approaches:

  • Binding assays: Test the ability of recombinant nqrC to bind its cofactors and electron transport partners. Previous studies with recombinant Neisserial proteins have shown that affinity chromatography can be used to assess binding capacity .

  • Enzymatic activity: Measure NADH oxidation and quinone reduction rates using spectrophotometric assays. Researchers should compare activity of the recombinant protein to that of the native complex isolated from N. meningitidis.

  • Structural analysis: Circular dichroism spectroscopy can verify proper protein folding, while limited proteolysis can assess domain organization.

  • Complementation studies: Express recombinant nqrC in nqrC-deficient strains to assess functional restoration.

Researchers should be aware that recombinant membrane proteins often require specific detergents or lipid environments to maintain function. Protocols should include careful optimization of buffer conditions, including pH, ionic strength, and stabilizing agents.

What methodological approaches are most effective for studying nqrC-mediated electron transport?

Studying nqrC-mediated electron transport requires specialized techniques:

  • Membrane potential measurements: Use fluorescent probes (e.g., DiSC3(5)) to monitor changes in membrane potential associated with nqrC activity.

  • Oxygen consumption assays: Employ oxygen electrodes to measure respiratory rates in intact cells or membrane vesicles with varying substrates.

  • Sodium transport assays: Use radioactive sodium (22Na+) or sodium-sensitive fluorescent probes to directly measure nqrC-dependent sodium transport.

  • Site-directed mutagenesis: Systematically modify key residues to identify those essential for electron transport and sodium pumping.

For effective results, researchers should:

  • Ensure anaerobic conditions when necessary

  • Control temperature precisely, as Na+-NQR activity is highly temperature-dependent

  • Include appropriate controls for non-specific membrane permeability

  • Consider the impact of lipid composition on complex activity

How does nqrC contribute to N. meningitidis adaptation during host colonization and invasion?

The nqrC protein likely plays a significant role in N. meningitidis adaptation to different host niches, as the bacterium transitions from commensal colonization of the nasopharynx to invasive disease. Research has shown that N. meningitidis encounters different environments with specific nutrient compositions during this process, requiring metabolic adaptation .

Small regulatory RNAs (sRNAs) such as Neisseria metabolic switch regulators (NmsRs) help regulate shifts between cataplerotic and anaplerotic metabolism, controlling enzymes involved in propionate metabolism and amino acid breakdown . These mechanisms may interact with or influence nqrC expression and function.

To study nqrC's role in host adaptation, researchers should:

  • Analyze nqrC expression in models that simulate different host niches (nasopharynx, bloodstream, cerebrospinal fluid)

  • Create nqrC mutants and assess their ability to survive in different host-mimicking conditions

  • Evaluate nqrC expression during transitions between aerobic and microaerobic environments

  • Investigate potential regulatory mechanisms controlling nqrC expression during host colonization

What is the relationship between nqrC function and virulence in hyperinvasive N. meningitidis lineages?

Evidence suggests that metabolic capabilities differ between hyperinvasive and non-hyperinvasive N. meningitidis lineages, which may involve variations in nqrC function or regulation. Studies have identified that about 40% of meningococcal core genes are affected by recombination, primarily within metabolic genes .

Data indicates that virulence in N. meningitidis is polygenic, with differences in metabolism potentially contributing to virulence . Lateral gene transfer and prophages are major forces shaping meningococcal population structure, with novel associations between virulence and genetic elements including RTX toxin and two-partner secretion systems .

Table 2: Metabolic Differences Between Hyperinvasive and Non-Hyperinvasive Lineages

Metabolic FeatureHyperinvasive LineagesNon-Hyperinvasive LineagesPotential Role of nqrC
Amino acid metabolism89 recombinant genes identifiedLower genetic variabilityMay affect energy generation for amino acid transport
Stress responseEnhanced stress response genesReduced stress toleranceCould influence energy availability during stress response
Energy metabolism26 recombinant genes identifiedLess metabolic flexibilityDirectly involves nqrC function
Carbohydrate utilization68 recombinant genesNarrower substrate rangeAffects energy availability for carbohydrate metabolism

To investigate this relationship, researchers should:

  • Compare nqrC sequence and expression between hyperinvasive and non-hyperinvasive lineages

  • Analyze the impact of nqrC mutations on virulence in animal models

  • Examine correlations between nqrC variants and clinical outcomes

  • Study the interaction between nqrC and known virulence factors

How does recombination affect nqrC evolution and function across Neisseria species?

Neisseria meningitidis shows extensive evidence of recombination, with 75% of all metabolic genes affected . This recombination impacts population structure and genome composition, potentially influencing nqrC evolution and function.

A comprehensive study analyzing 2839 meningococcal genomes found that recombination principally acts to prevent accumulation of deleterious mutations, though it can also speed adaptation of genes . Some lineages were found to be orders of magnitude more recombinant than others, suggesting variable evolutionary pressures.

To study nqrC evolution through recombination:

  • Perform phylogenetic analyses of nqrC across multiple Neisseria species and strains

  • Calculate dN/dS ratios to identify selection pressures

  • Use recombination detection algorithms to identify potential recombination events in nqrC

  • Correlate recombination events with functional changes in the protein

The ortholog analysis presented in search result provides a starting point, showing nqrC relationships across different bacterial species including Bacteroides thetaiotaomicron, Lewinella agarilytica, and Actinobacillus seminis.

What structural and functional interactions exist between nqrC and other components of the respiratory chain?

The nqrC protein functions as part of the Na(+)-NQR complex, interacting with other components of the respiratory chain. Understanding these interactions requires advanced structural and functional studies.

Research approaches should include:

  • Protein-protein interaction studies using techniques such as bacterial two-hybrid systems or co-immunoprecipitation

  • Cross-linking studies to identify interaction interfaces

  • Cryo-electron microscopy to determine complex structure

  • Molecular dynamics simulations to predict functional interactions

Recent studies in related bacteria suggest that the Na(+)-NQR complex interacts with other respiratory components, forming respiratory supercomplexes that enhance electron transfer efficiency. This possibility should be investigated in N. meningitidis as well.

How do metabolic adaptations involving nqrC contribute to antibiotic resistance mechanisms in N. meningitidis?

Metabolic adaptations can contribute to antibiotic tolerance and resistance. The role of nqrC in these processes is an emerging area of research that deserves investigation.

Potential mechanisms include:

  • Alterations in membrane potential affecting uptake of charged antibiotics

  • Metabolic adaptations that bypass inhibited pathways

  • Energy-dependent efflux pump activity requiring functional nqrC

  • Persister cell formation through changes in energy metabolism

Research approaches should include:

  • Comparing nqrC expression in antibiotic-resistant versus susceptible strains

  • Measuring antibiotic susceptibility in nqrC mutants

  • Analyzing correlations between nqrC variants and minimum inhibitory concentrations

  • Studying the effect of respiratory inhibitors on antibiotic efficacy

How does nqrC function compare between pathogenic Neisseria species and commensal Neisseria species?

Comparative analysis of nqrC between pathogenic (N. meningitidis, N. gonorrhoeae) and commensal Neisseria species can provide insights into its role in pathogenesis. While both pathogenic species have evolved from a common ancestor , they occupy distinct niches in the human body.

Table 3: Comparative Features of nqrC Across Neisseria Species

FeatureN. meningitidisN. gonorrhoeaeCommensal NeisseriaSignificance
Gene conservationPresentPresentVariable presenceSuggests core metabolic function
Expression patternsVaries with oxygen availabilitySimilar to N. meningitidisLess studiedReflects niche adaptation
Structural variationsReferenceHighly similarMore divergentIndicates evolutionary path
Functional differencesSodium pumping, energy conservationSimilar functionMay have alternative rolesRelated to metabolic capabilities

Research methods should include:

  • Comparative genomics across Neisseria species focusing on nqrC and related genes

  • Heterologous expression studies swapping nqrC between species

  • Functional characterization under conditions mimicking different host niches

  • Analysis of selection pressures on nqrC in different Neisseria lineages

What role does nqrC play in the adaptation of N. meningitidis to different microenvironments in the human host?

N. meningitidis encounters various microenvironments during colonization and invasion, including the oxygen-rich nasopharynx, oxygen-limited tissues, and nutrient-variable bloodstream. The nqrC protein likely contributes to adaptation to these environments.

Studies have shown that N. meningitidis can use nitrite as an alternative respiratory substrate under oxygen limitation through a truncated denitrification pathway . This flexibility may involve nqrC function.

Additionally, recent research has identified a MenY ST1466 strain capable of causing both urethritis and invasive meningococcal disease, demonstrating adaptation to different host niches . The role of energy metabolism, including nqrC, in this adaptability warrants investigation.

Research approaches should include:

  • Transcriptomic and proteomic analysis of N. meningitidis under different environmental conditions

  • Metabolic flux analysis using isotope-labeled substrates

  • Competition assays between wild-type and nqrC mutants in different microenvironments

  • Analysis of nqrC regulation by environmental sensing systems

How can systems biology approaches integrate nqrC function into comprehensive models of meningococcal metabolism?

Systems biology approaches can place nqrC within the broader context of meningococcal metabolism, providing a more complete understanding of its role.

Previous modeling efforts have developed a genome-scale metabolic network for N. meningitidis comprising 1255 reactions encoded by 586 genes . Integrating nqrC function into these models requires:

  • Updating existing metabolic models with detailed information about electron transport chain components

  • Incorporating regulatory networks that control nqrC expression

  • Developing kinetic models of Na(+)-NQR activity under different conditions

  • Integrating transcriptomic, proteomic, and metabolomic data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.