Recombinant Neisseria meningitidis serogroup A / serotype 4A Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

The recombinant Na⁺-translocating NADH-quinone reductase subunit E (nqrE) is a component of the Na⁺-NQR complex in Neisseria meningitidis, a Gram-negative bacterium responsible for invasive meningococcal disease. This subunit belongs to a multi-protein complex that catalyzes the oxidation of NADH and the reduction of quinones, coupling this redox reaction to the translocation of Na⁺ ions across the bacterial membrane. The recombinant version of nqrE is produced via heterologous expression systems (e.g., E. coli) for research purposes, including vaccine development, diagnostic assays, and studies of bacterial energy metabolism .

Research Applications

The recombinant nqrE protein serves as a critical tool in:

  • Immunological Studies: Used in ELISA and Western blotting to detect anti-nqrE antibodies, aiding in serotyping and vaccine efficacy assessments .

  • Vaccine Development: As a component of subunit vaccines targeting N. meningitidis serogroup A, leveraging its conserved epitopes .

  • Structural Biology: Facilitating crystallography and functional studies of the NQR complex’s Na⁺-pumping mechanism .

Serotyping and Epidemiological Relevance

Serogroup A strains, particularly serotype 4A, are historically linked to large-scale epidemics in sub-Saharan Africa and other regions . The nqrE protein’s association with serotype 4A is critical for distinguishing it from other serotypes (e.g., serotype 21) using monoclonal antibodies .

SerogroupSerotypeKey Features
A4APorB allele 60; linked to ST-1 and ST-5 clonal complexes; nqrE expressed with FetA F5-1 or F3-1 antigens
B4Reacts with multiple anti-serotype 4 antibodies; distinct from serogroup A strains in multilocus enzyme electrophoresis

Production and Quality Control

Recombinant nqrE is produced with rigorous quality assurance:

  • Purity: >85% (SDS-PAGE validation) .

  • Endotoxin Levels: Low-endotoxin variants available for immunological assays .

  • Functionality: Tested in ELISA and Western blotting to confirm antigenicity .

Comparative Analysis with Other Serogroups

FeatureSerogroup A (4A)Serogroup C
nqrE SequenceQ9JVQ2 (197 aa) A9M2A7 (197 aa)
TaggingTris-based buffer N-terminal His-tag
Antigenic SpecificitySerotype 4A-specific epitopes Broad reactivity across serogroups (hypothetical)

Challenges and Future Directions

While recombinant nqrE has advanced vaccine and diagnostic research, challenges include:

  • Antigenic Diversity: Limited data on cross-reactivity with non-serogroup A strains .

  • Epidemiological Tracking: Serogroup A’s clonal structure (ST-1/ST-5 complexes) requires ongoing surveillance .

  • Therapeutic Potential: Exploring nqrE as a target for antimicrobial agents disrupting Na⁺-dependent respiration .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Please note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; NMA0748; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
nqrE
Target Protein Sequence
MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPANQLVY SLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCA IFGAVSFMAQREYGFGESVVYGFGAGLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFI AAGLMAMAFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: nma:NMA0748

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Na(+)-translocating NADH-quinone reductase subunit E (nqrE) in Neisseria meningitidis?

Na(+)-translocating NADH:quinone oxidoreductase (Na(+)-NQR) is a respiratory enzyme complex that catalyzes electron transfer from NADH to ubiquinone, coupled with sodium ion translocation across the bacterial membrane . This process is critical for bacterial energy metabolism and establishes an electrochemical gradient used for various cellular functions. The nqrE subunit serves as an integral component of the Na(+)-NQR complex, working alongside five other subunits (NqrA through NqrF) to facilitate this energy transduction process. Based on research findings, nqrE forms a crucial (Cys)4[Fe] center with the NqrD subunit that likely participates in the electron transfer pathway of the enzyme complex . This iron-sulfur center represents a critical structural feature that enables the enzyme to function properly in electron transport. The Na(+)-NQR complex as a whole exhibits both Na(+)-dependent quinone reductase activity and Na(+)-independent NADH dehydrogenase activity, with the different subunits contributing to these diverse functions .

What experimental approaches are recommended for cloning and expressing recombinant nqrE from Neisseria meningitidis?

Successful cloning and expression of recombinant nqrE requires careful consideration of several methodological aspects. Researchers should first extract genomic DNA from N. meningitidis using established protocols similar to those used for other meningococcal proteins . The nqrE gene can be amplified using PCR with primers designed to include appropriate restriction sites that facilitate subsequent cloning steps. Following amplification, the PCR product should be cloned into an intermediate vector before subcloning into an expression vector optimized for membrane proteins . Expression systems should be carefully selected, with E. coli being a common choice, though expression may be challenging due to the membrane-associated nature of nqrE. The critical consideration when expressing recombinant nqrE is the need for co-expression with other components of the Na(+)-NQR complex, particularly NqrD with which it forms the iron-sulfur center, and potentially the maturation factor NqrM . Research indicates that expression of the Na(+)-NQR complex without proper maturation factors results in non-functional enzyme lacking Na(+)-dependent activity .

What challenges are encountered in purifying functional nqrE protein, and how can they be addressed?

Purification of functional nqrE presents several technical challenges that researchers must overcome. As a membrane protein component of a multi-subunit complex, nqrE is inherently difficult to express and purify in a functional state. The protein contains hydrophobic transmembrane domains that make it prone to aggregation when removed from the membrane environment. Additionally, the functional state of nqrE depends on proper formation of the (Cys)4[Fe] center with NqrD, which requires specific maturation factors including NqrM . To address these challenges, researchers should consider using mild detergents specifically optimized for membrane protein extraction and purification. Co-expression with other Na(+)-NQR subunits and the maturation factor NqrM significantly improves the likelihood of obtaining functionally active protein . Affinity tags can facilitate purification, though careful placement is necessary to avoid interfering with protein function or complex assembly. The purification protocol should minimize exposure to oxidizing conditions that might disrupt the iron-sulfur center, potentially using oxygen-free environments during key purification steps.

What role does the NqrM protein play in the maturation and assembly of nqrE within the Na(+)-NQR complex?

NqrM, previously annotated as DUF539 (Domain of Unknown Function 539), has been identified as an essential maturation factor for the Na(+)-NQR complex, with specific involvement in the assembly of the (Cys)4[Fe] center between nqrD and nqrE . Research demonstrates that NqrM contains a single putative transmembrane α-helix and four conserved cysteine residues that are critical for its function. Expression studies have conclusively shown that functional Na(+)-NQR cannot be produced in the absence of NqrM, even when all six structural subunits and the flavin transferase ApbE are present . The Na(+)-NQR complex isolated from nqrM-deficient strains lacks several subunits, indicating that NqrM plays a crucial role in the proper assembly of the entire complex rather than just in cofactor insertion . Mutational analysis has revealed that Cys33 in NqrM is absolutely essential for function, as its mutation to serine completely prevents Na(+)-NQR maturation, while mutations of other conserved cysteine residues merely decrease the yield of mature complex . These findings suggest that NqrM likely functions as an iron chaperone, using its conserved cysteine residues to transiently bind iron and deliver it specifically to the forming nqrD-nqrE subcomplex for incorporation into the (Cys)4[Fe] center.

How can recombinant nqrE be used in structural studies of the Na(+)-NQR complex, and what methodological approaches overcome the challenges of membrane protein crystallization?

Structural studies of recombinant nqrE present significant challenges due to its membrane-embedded nature and its functional dependence on interactions with other Na(+)-NQR subunits. To successfully utilize recombinant nqrE in structural investigations, researchers must employ specialized approaches tailored to membrane proteins. Co-expression of the entire Na(+)-NQR complex, including nqrE along with the other five structural subunits and necessary maturation factors, represents the most promising strategy for obtaining properly assembled protein suitable for structural studies . For X-ray crystallography attempts, researchers should screen various detergents to identify those that maintain the native structure while facilitating crystal formation. Lipidic cubic phase crystallization has emerged as a particularly effective method for membrane proteins and could be applied to Na(+)-NQR complexes containing nqrE. Cryo-electron microscopy (cryo-EM) offers significant advantages for studying membrane protein complexes like Na(+)-NQR, as it avoids the need for crystal formation and can capture the protein in a more native-like environment. To enhance stability during purification and crystallization, antibody fragments or nanobodies that bind specifically to extramembrane regions of nqrE can be employed as crystallization chaperones.

What experimental approaches can quantify the contribution of nqrE to Na(+) translocation activity in the Na(+)-NQR complex?

Quantifying the specific contribution of nqrE to Na(+) translocation requires sophisticated biophysical and biochemical approaches that can dissect the functions of individual subunits within the complex enzyme system. Site-directed mutagenesis of conserved residues in nqrE, particularly those involved in the (Cys)4[Fe] center formation with nqrD, provides a direct approach to assess how specific structural elements contribute to Na(+) pumping activity . Researchers can create a series of point mutations and evaluate their impact on both electron transfer and ion translocation functions. Reconstitution of purified Na(+)-NQR complex containing wild-type or mutant nqrE into proteoliposomes allows for direct measurement of Na(+) transport using 22Na(+) as a radioactive tracer or sodium-sensitive fluorescent dyes. Electrophysiological techniques, including solid-supported membrane electrophysiology, can measure charge translocation associated with Na(+) pumping in real-time, providing kinetic information about the transport process. Researchers can also employ Na(+)-dependent enzyme activity assays to correlate electron transfer rates with ion translocation efficiency, potentially identifying conditions or mutations that uncouple these processes.

How do genomic variations in nqrE across different Neisseria meningitidis strains correlate with functional differences and adaptive advantages?

Genomic variations in nqrE across different N. meningitidis strains likely contribute to functional differences in Na(+)-NQR activity that may confer adaptive advantages in specific host environments. Research has demonstrated that N. meningitidis undergoes extensive lateral gene transfer and recombination, which shapes its population structure and contributes to virulence evolution . Approximately 40% of meningococcal core genes show evidence of recombination, with metabolic genes being particularly affected . To investigate the functional consequences of nqrE variations, researchers should perform comparative genomic analysis across diverse meningococcal lineages, including both hyperinvasive and non-hyperinvasive strains. Sequence variations in regions encoding the cysteine residues involved in the (Cys)4[Fe] center would be particularly significant as they directly impact electron transfer function. Experimental approaches could include creating chimeric proteins or site-directed mutants based on naturally occurring variations and assessing their effects on Na(+)-NQR assembly, stability, and catalytic activity . The differential distribution of genes encoding various protein secretion systems between hyperinvasive and non-hyperinvasive lineages suggests that similar patterns might exist for metabolic genes like nqrE .

What is the optimal experimental design for assessing the enzymatic activity of recombinant Na(+)-NQR complexes containing nqrE?

The optimal experimental design for assessing enzymatic activity of recombinant Na(+)-NQR complexes containing nqrE must account for the complex nature of this membrane-bound enzyme and its dual catalytic functions. Researchers should express the complete Na(+)-NQR complex, including all six structural subunits (NqrA-F) along with the maturation factors ApbE and NqrM, which are essential for assembling a functional complex with proper cofactor incorporation . Expression in a heterologous system like E. coli requires careful optimization, as demonstrated by research showing that expression of the nqr operon alone or even with ApbE is insufficient for producing functional enzyme . Following expression, the complex should be solubilized using detergents that maintain enzyme integrity and purified using affinity chromatography. Activity assays should measure both Na(+)-dependent quinone reductase activity and Na(+)-independent NADH dehydrogenase activity under varying sodium concentrations to distinguish between these functions . Spectrophotometric assays typically monitor the oxidation of NADH at 340 nm, with quinone reduction measured by absorbance changes at appropriate wavelengths for the specific quinone used.

What methods are most effective for studying protein-protein interactions between nqrE and other subunits of the Na(+)-NQR complex?

Investigating protein-protein interactions between nqrE and other Na(+)-NQR subunits requires specialized approaches suited to membrane protein complexes. Cross-linking studies using chemical cross-linkers of varying lengths can identify proximity relationships between nqrE and other subunits, with subsequent mass spectrometry analysis identifying specific interaction sites. Co-immunoprecipitation experiments using antibodies directed against nqrE or other subunits can pull down interaction partners, though care must be taken with detergent selection to maintain native interactions. Bacterial two-hybrid systems adapted for membrane proteins provide a genetic approach to screen for interactions, potentially identifying residues critical for complex assembly. Förster resonance energy transfer (FRET) between fluorescently labeled subunits offers a means to study interactions in real-time and in membrane environments. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) identifies regions of proteins that become protected upon complex formation, providing detailed information about interaction interfaces. These complementary approaches can generate a comprehensive map of how nqrE interacts with other components of the Na(+)-NQR complex, particularly its direct partner nqrD with which it forms the critical (Cys)4[Fe] center .

What techniques are most appropriate for analyzing the iron-binding properties of recombinant nqrE?

Analyzing the iron-binding properties of recombinant nqrE requires specialized techniques that can detect and characterize metal coordination in proteins. Inductively coupled plasma mass spectrometry (ICP-MS) provides precise quantification of iron content in purified nqrE preparations, establishing the stoichiometry of metal binding. Electron paramagnetic resonance (EPR) spectroscopy is particularly valuable for characterizing the electronic properties of the iron center, including oxidation state and coordination environment . Mössbauer spectroscopy offers detailed information about the chemical environment of iron nuclei and is especially useful for distinguishing different types of iron centers. X-ray absorption spectroscopy (XAS), including both X-ray absorption near-edge structure (XANES) and extended X-ray absorption fine structure (EXAFS), provides information about oxidation state and the atomic structure surrounding the iron atom. UV-visible absorption spectroscopy can track changes in iron coordination through characteristic absorption bands associated with different iron-sulfur cluster types. Site-directed mutagenesis of conserved cysteine residues, followed by these spectroscopic analyses, can identify which residues directly coordinate iron and how they contribute to the properties of the metal center formed between nqrE and nqrD .

How can researchers effectively analyze the membrane topology and structural features of nqrE?

Determining the membrane topology and structural features of nqrE requires specialized approaches for membrane proteins. Computational prediction tools provide initial models based on hydrophobicity analysis and evolutionary conservation, but experimental validation is essential. Cysteine scanning mutagenesis followed by accessibility labeling with membrane-permeable and membrane-impermeable sulfhydryl reagents can map which regions are exposed to different cellular compartments. Protease protection assays using proteases that cannot cross the membrane identify loops exposed on different sides of the membrane. Gene fusion approaches using reporter enzymes like alkaline phosphatase or beta-galactosidase, which function only in specific cellular compartments, provide another means to map topology. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) identifies regions accessible to solvent, helping distinguish membrane-embedded from solvent-exposed regions. For higher-resolution structural information, techniques like cryo-electron microscopy of the entire Na(+)-NQR complex are particularly promising, especially given recent advances in resolving membrane protein structures . These approaches, used in combination, can generate a detailed topological map of nqrE within the membrane and identify structural features critical for its role in the Na(+)-NQR complex.

Key components and maturation factors for functional Na(+)-NQR complex

ComponentFunctionCritical FeaturesResearch Findings
NqrACore structural componentCytoplasmic subunitPart of minimal functional unit
NqrBElectron transferContains covalently bound FMNRequires ApbE for FMN attachment
NqrCElectron transferContains covalently bound FMNRequires ApbE for FMN attachment
NqrDElectron transferForms (Cys)4[Fe] center with NqrERequires NqrM for iron center formation
NqrEElectron transferForms (Cys)4[Fe] center with NqrDRequires NqrM for iron center formation
NqrFNADH bindingContains FAD and FeS centerInitial electron acceptor from NADH
ApbEMaturation factorFlavin transferaseCatalyzes covalent FMN attachment to NqrB and NqrC
NqrMMaturation factorContains four conserved Cys residuesEssential for (Cys)4[Fe] center formation between NqrD and NqrE

The Na(+)-NQR complex represents a sophisticated respiratory enzyme requiring multiple protein components and specific maturation factors to achieve functional assembly. Research has demonstrated that the complex consists of six structural subunits (NqrA through NqrF) that work together to couple NADH oxidation with Na(+) translocation . Each subunit serves specific roles in the electron transfer pathway, with NqrF binding NADH and containing FAD, while NqrB and NqrC contain covalently bound FMN cofactors that participate in electron transfer. The NqrD and NqrE subunits form a critical (Cys)4[Fe] center that bridges these proteins and participates in electron transfer . Two specific maturation factors, ApbE and NqrM, are essential for proper assembly of the complex. ApbE functions as a flavin transferase that catalyzes the covalent attachment of FMN to specific threonine residues in NqrB and NqrC . NqrM plays a crucial role in the formation of the iron-sulfur center between NqrD and NqrE, likely by facilitating iron delivery and incorporation into the complex .

Experimental evidence for NqrM requirement in functional Na(+)-NQR assembly

Experimental ConditionObserved OutcomeFunctional Na(+)-NQRReference
Expression of nqr operon alone in E. coliComplex assemblyNo
Expression of nqr operon + apbE in E. coliComplex with FMN incorporationNo
Expression of nqr operon + apbE + nqrM in E. coliComplete complex with iron centerYes
nqrM mutations in Vibrio harveyiVariable outcomes based on mutationVariable
Cys33Ser mutation in NqrMComplete loss of Na(+)-NQR activityNo
Mutations of other conserved Cys in NqrMDecreased yield of mature complexReduced
nqrM lesions in Klebsiella pneumoniae and V. harveyiNo functional Na(+)-NQRNo

Relationship between metabolism, recombination, and virulence in Neisseria meningitidis

Genetic ElementAssociation with VirulenceAffected by RecombinationResearch Findings
Metabolic genesYesYes, ~40% show recombinationDifferences in metabolism might contribute to virulence
Meningococcal Disease Associated (MDA) islandYesYesPreviously known virulence factor
IHT-E canonical genomic islandYesYesNewly identified association with virulence
RTX toxin genesYesYesDifferential distribution between hyperinvasive and non-hyperinvasive lineages
Two-partner secretion system genesYesYesDifferential distribution between hyperinvasive and non-hyperinvasive lineages
DNA replication and repair genesUnknownYes, highly affectedPotential indirect impact on adaptation and virulence

Research on Neisseria meningitidis has revealed complex relationships between metabolism, genomic recombination, and virulence potential. Studies combining comparative genome hybridization and multilocus sequence typing have demonstrated that lateral gene transfer and recombination significantly impact meningococcal population structure and contribute to virulence evolution . Analysis indicates that approximately 40% of meningococcal core genes show evidence of recombination, with metabolic genes being particularly affected . This finding supports the hypothesis that meningococcal virulence is polygenic in nature and that differences in metabolic capabilities might contribute significantly to pathogenic potential . Beyond previously identified virulence factors like the meningococcal disease associated (MDA) island, research has identified new associations between virulence and genetic elements such as the canonical genomic island termed IHT-E . Additionally, genes encoding RTX toxin- and two-partner secretion systems show differential distribution among hyperinvasive and non-hyperinvasive lineages, suggesting their contribution to virulence differences . The high prevalence of recombination in DNA replication and repair genes may indirectly influence virulence by affecting genome stability and adaptation capabilities .

Development of inhibitors targeting the nqrE subunit as potential antimicrobial agents

The essential role of Na(+)-NQR in bacterial energy metabolism and its absence in human cells makes it an attractive target for antimicrobial development, with nqrE offering potential specific targeting opportunities. Structure-based drug design approaches could target the unique (Cys)4[Fe] center formed between nqrE and nqrD, potentially disrupting electron transfer through the complex. High-throughput screening using recombinant Na(+)-NQR complex could identify molecules that specifically inhibit activity, with follow-up studies to determine if they specifically interact with nqrE. Peptide inhibitors designed to mimic interaction interfaces between nqrE and other subunits could disrupt complex assembly. Molecules targeting the NqrM maturation pathway represent an indirect approach to prevent functional nqrE incorporation into the complex . Any identified inhibitors should be evaluated for antimicrobial activity against N. meningitidis and other pathogens containing Na(+)-NQR, with particular attention to effects on growth under sodium-rich conditions that mimic the host environment. Preclinical development would need to assess pharmacokinetic properties, toxicity, and potential for resistance development through mutations in nqrE or related proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.