Recombinant Neisseria meningitidis serogroup A / serotype 4A NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Neisseria meningitidis

Neisseria meningitidis is a major causative agent of bacterial meningitis and sepsis worldwide, with significant morbidity and mortality rates. The bacterium has 13 identified serogroups, with six (A, B, C, W, X, and Y) being the most epidemiologically significant and capable of causing epidemics . Among these, serogroup A has historically been associated with large epidemics, particularly in the "meningitis belt" of sub-Saharan Africa.

Several virulence factors contribute to the pathogenicity of N. meningitidis, including its polysaccharide capsule, outer membrane proteins, and various metabolic enzymes that enable survival in the host environment . The bacterium's metabolic capabilities, including its respiratory chain components like nuoK, are crucial for its survival and pathogenicity.

NADH-Quinone Oxidoreductase Complex

NADH-quinone oxidoreductase, also known as Complex I or NADH dehydrogenase, is a fundamental enzyme in the respiratory chain of many bacteria, including N. meningitidis. This complex catalyzes the transfer of electrons from NADH to quinone, coupled with proton or sodium ion translocation across the membrane, generating the proton motive force necessary for ATP synthesis.

In bacterial systems, Complex I typically consists of 14 subunits (NuoA-N), with nuoK being one of several membrane-embedded components. These subunits work together to facilitate the electron transfer and ion translocation processes essential for energy production. Studies on the Na⁺-translocating NADH:quinone oxidoreductase from Vibrio cholerae have shown high specific activity in the presence of sodium, with NADH consumption at a turnover number of 720 electrons per second .

The membrane-associated nature of NADH-quinone oxidoreductase and its role in bacterial energy metabolism make it a potential target for antimicrobial development, as disruption of this complex could impair bacterial energy production and survival.

Recombinant Expression

The production of recombinant nuoK typically follows standard recombinant protein expression protocols. The nuoK gene from N. meningitidis serogroup A / serotype 4A is cloned into an expression vector, often with a His-tag sequence to facilitate purification. This construct is then transformed into an E. coli expression host .

Expression is induced under controlled conditions, often using IPTG (Isopropyl β-D-1-thiogalactopyranoside) for systems with T7 or lac promoters, similar to the approach used for other recombinant N. meningitidis proteins . The expression conditions, including temperature, induction time, and media composition, are optimized to maximize protein yield while maintaining proper folding.

Similar approaches have been successfully applied to other N. meningitidis proteins such as transferrin binding proteins (TbpA and TbpB), which retained their functional activity when expressed recombinantly , suggesting that recombinant nuoK likely maintains its native structure as well.

Purification Process

The purification of recombinant nuoK typically follows these steps:

  1. Cell harvesting and lysis to release the recombinant protein

  2. Clarification of the lysate by centrifugation

  3. Ni-NTA affinity chromatography, utilizing the His-tag for specific binding

  4. Washing to remove non-specifically bound proteins

  5. Elution with imidazole-containing buffers

  6. Dialysis or buffer exchange to remove imidazole and other contaminants

  7. Concentration and lyophilization (if required)

The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis . The use of affinity chromatography allows for a relatively straightforward purification process, yielding protein suitable for various research applications.

Functional Role in Neisseria meningitidis

As a subunit of the NADH-quinone oxidoreductase complex, nuoK is likely involved in the proton translocation mechanism that couples electron transfer to the generation of a proton gradient across the membrane. This proton gradient is essential for energy production via ATP synthesis.

In bacterial systems, the membrane-embedded subunits of Complex I, including nuoK, form a structure that facilitates proton movement across the membrane. While specific research on nuoK in N. meningitidis is limited in the available literature, studies on NADH:quinone oxidoreductase in other bacteria such as Vibrio cholerae have shown that these enzymes can generate sodium gradients and membrane potential (ΔΨ) when reconstituted into liposomes .

The importance of respiratory chain components like nuoK for bacterial survival makes them potential targets for antimicrobial development. The nuoK protein, as part of Complex I, contributes to the bacterium's ability to generate energy under various environmental conditions, potentially including during infection when oxygen levels may be limited or other stress conditions are present.

Research Applications

Recombinant nuoK from N. meningitidis serogroup A has several potential applications in research:

ApplicationPurposeAdvantages
Immunological ResearchStudy of antibody responsesHigh purity protein for specific response analysis
Structural StudiesDetermination of protein structureHelps understand function and potential drug targets
Vaccine ResearchComponent for potential subunit vaccinesSpecific antigen for targeted immune response
Diagnostic DevelopmentBiomarker for detectionMay help distinguish between serogroups
Drug DiscoveryTarget for antimicrobial developmentEssential component of bacterial metabolism

Immunological Studies

Recombinant nuoK can serve as a valuable tool for studying the immune response to N. meningitidis. By analyzing antibody responses to specific components like nuoK, researchers can better understand host-pathogen interactions and potentially identify correlates of protection against meningococcal disease.

This approach has been successfully applied with other N. meningitidis proteins. For example, recombinant transferrin binding proteins from N. meningitidis have been evaluated for their ability to protect against meningococcal infection and to induce cross-reactive and bactericidal antibodies . Similar studies with recombinant nuoK could provide insights into its potential role in protective immunity.

Vaccine Development

While vaccines exist for several serogroups of N. meningitidis, ongoing research aims to improve their efficacy and develop new approaches. Currently, there are polysaccharide conjugate vaccines against serogroups A, C, W, and Y, as well as two recombinant peptide vaccines against serogroup B .

Recombinant proteins like nuoK could potentially serve as components in subunit vaccines or as antigens for research into vaccine development strategies. Studies have shown that recombinant outer membrane proteins of N. meningitidis can elicit protective immune responses . Although nuoK is not currently included in meningococcal vaccines, research on its immunogenicity could contribute to our understanding of potential vaccine candidates.

Comparative Analysis with Other Serogroups

Comparison of nuoK across different N. meningitidis serogroups could provide insights into functional differences and potential implications for pathogenicity. Whole genome analysis of N. meningitidis isolates has revealed considerable genetic diversity, particularly among serogroup B isolates .

Serogroup B isolates have shown high heterogeneity, with common clonal complexes including cc18, cc32, cc35, cc41/44, and cc269 . In contrast, serogroup C isolates predominantly belong to clonal complex cc11. Such genomic analyses could potentially reveal variations in the nuoK gene across different serogroups and clonal complexes.

Understanding the conservation or variation of nuoK across serogroups could inform our understanding of the protein's essentiality and potential as a therapeutic target. Conserved proteins that are essential for bacterial survival across multiple serogroups represent attractive targets for broad-spectrum interventions.

Future Research Directions

Several avenues for future research on nuoK from N. meningitidis serogroup A warrant exploration:

  1. Functional characterization to elucidate its precise role in the respiratory chain and energy metabolism of N. meningitidis

  2. Structural studies to determine its three-dimensional conformation and interaction with other Complex I subunits

  3. Investigation of its potential as a therapeutic target for antimicrobial development, including screening for specific inhibitors

  4. Exploration of its immunogenicity and potential role in vaccine strategies

  5. Comparative genomic and proteomic analyses across serogroups to identify significant variations and their functional implications

  6. Studies of protein-protein interactions to understand how nuoK integrates into the larger Complex I structure

These research directions could significantly enhance our understanding of nuoK's role in N. meningitidis biology and potentially inform therapeutic strategies against meningococcal disease.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific requirement for the format, please indicate your preference in the order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery information, please contact your local distributor.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
nuoK; NMA0005; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
nuoK
Target Protein Sequence
MITLTHYLVLGALLFGISAMGIFMNRKNVLVLLMSIELMLLAVNFNFIAFSQHLGDTAGQ IFVFFVLTVAAAESAIGLAIMVLVYRNRQTINVADLDELKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy in a proton gradient.
Database Links

KEGG: nma:NMA0005

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.