Recombinant Neisseria meningitidis serogroup A / serotype 4A Prolipoprotein diacylglyceryl transferase (lgt)

What is the molecular structure of Neisseria meningitidis lgt protein?

Prolipoprotein diacylglyceryl transferase (lgt) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) is a 283-amino acid protein with a complete UniProt accession number of Q9JUK4. The full amino acid sequence is: MITHPQFDPVLISIGPLAVRWYALSYILGFILFTFLGRRRIAQGLSVFTKESLDDFLTWGILGVILGGRLGYVLFYKFSDYLAHPLDIFKVWEGGMSFHGGFLGVVIAIWLFGRKHGIGFLKLMDTVAPLVPLGLASGRIGNFINGELWGRVTDINAFWAMGFPQARYEDLEAAAHNPLWAEWLQQYGMLPRHPSQLYQFALEGICLFAVVWLFSKKQRPTGQVASLFLGGYGIFPFIAFARQPDDYLGLLTLGLSMGQWLSVPMIVLGIVGFVRFGMKKQH . The protein contains membrane-spanning domains typical of integral membrane proteins, with hydrophobic regions that anchor it within the bacterial membrane.

How does lgt differ from other similarly named genes in N. meningitidis?

It is essential to distinguish lgt (Prolipoprotein diacylglyceryl transferase) from other similarly named genes in N. meningitidis, particularly the lgtA, lgtB, and lgtE genes. While lgt functions in lipoprotein processing by transferring diacylglyceryl to prolipoprotein signal peptides, the lgtABE genes encode glycosyltransferases involved in lipooligosaccharide (LOS) biosynthesis. Specifically, lgtA encodes a beta-N-acetylglucosaminyltransferase that catalyzes the transfer of GlcNAc in a beta 1→3-linkage to galactose residues in the synthesis of the lacto-N-neo-tetraose structural element of bacterial LOS . This functional distinction is critical when designing experiments targeting specific bacterial metabolic pathways.

What are the key structural domains of lgt and their roles in functional diversity?

Recent research indicates that lgt contains distinct "arm" and "head" domains that determine functional diversity among bacterial pathogens . These domains, particularly in conjunction with histidine 103, play crucial roles in determining protein substrate specificity . The membrane topology of lgt positions these domains to interact with both membrane components and prolipoprotein substrates. The structural organization allows lgt to recognize specific signal peptides on prolipoproteins and catalyze the transfer of diacylglyceryl groups from phospholipids to conserved cysteine residues in these signal sequences.

What expression systems are most effective for producing recombinant N. meningitidis lgt?

For optimal expression of recombinant N. meningitidis lgt, heterologous expression in Escherichia coli has proven effective, similar to the successful expression of other Neisseria glycosyltransferases . When expressing membrane proteins like lgt, specialized E. coli strains (such as C41(DE3) or C43(DE3)) that are optimized for membrane protein expression are recommended. Expression protocols typically involve:

• Cloning the lgt gene into vectors with inducible promoters (e.g., pET series)

• Transformation into expression hosts

• Induction with IPTG at reduced temperatures (16-20°C) to enhance proper folding

• Extended expression periods (16-24 hours) to maximize yield

The addition of detergents during cell lysis and subsequent purification steps is critical for maintaining protein solubility and activity.

What are the optimal storage conditions for maintaining lgt enzyme activity?

Based on related recombinant protein storage information, purified lgt should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can significantly reduce enzymatic activity . Addition of reducing agents such as DTT or β-mercaptoethanol (1-5 mM) may help maintain cysteine residues in their reduced state and preserve enzyme function.

What purification strategies provide the highest yield and purity of functional lgt?

Detergent selection is crucial for membrane protein purification. n-Dodecyl β-D-maltoside (DDM) is often effective, but screening multiple detergents (LDAO, OG, Triton X-100) may be necessary to optimize activity retention. The purification protocol should be validated by assessing the enzymatic activity of the final preparation using appropriate activity assays.

What enzymatic assays can be used to measure lgt activity in vitro?

Lgt catalyzes the transfer of diacylglyceryl groups from phospholipids to specific cysteine residues in prolipoprotein signal peptides. Several assays can be employed to measure this activity:

• Radiolabeled substrate assay: Using 3H or 14C-labeled phospholipids as donors and monitoring the transfer of labeled diacylglyceryl to prolipoprotein acceptors.

• Fluorescent detection assay: Employing fluorescently labeled synthetic peptides containing the lipobox motif as acceptors, with activity measured as changes in fluorescence properties upon diacylglyceryl transfer.

• Mass spectrometry-based assay: Detecting mass shifts in prolipoprotein substrates following diacylglyceryl transfer, which can be performed using MALDI-TOF or ESI-MS approaches similar to those used for analyzing LOS modifications .

• HPLC separation: Quantifying both substrate depletion and product formation using chromatographic separation techniques.

These assays must include appropriate controls to confirm that observed activity is specifically due to lgt function.

How does N. meningitidis lgt interact with its substrates?

N. meningitidis lgt recognizes prolipoproteins through specific signal peptides containing a conserved "lipobox" motif with the consensus sequence [LVI][ASTVI][GAS][C]. The enzyme catalyzes the attachment of a diacylglyceryl group to the thiol group of the conserved cysteine residue in this motif. Recent structural studies suggest that the arm and head domains of lgt determine substrate specificity . The membrane-embedded regions of the enzyme allow access to phospholipid donors, while the exposed domains interact with the prolipoprotein substrates. The histidine 103 residue appears particularly important for substrate recognition and catalysis .

What high-resolution structural methods are most effective for studying lgt?

Given the membrane-associated nature of lgt, the following structural techniques have proven valuable for studying similar proteins:

• X-ray crystallography: Requires successful crystallization of the detergent-solubilized protein, often facilitated by:

  • Truncation of flexible regions

  • Use of lipidic cubic phase crystallization approaches

  • Co-crystallization with stabilizing antibody fragments

• Cryo-electron microscopy (cryo-EM): Increasingly useful for membrane proteins, avoiding the need for crystallization.

• NMR spectroscopy: While challenging for full-length membrane proteins, can provide valuable information on substrate binding and dynamics of specific domains.

• Molecular dynamics simulations: Complementary computational approach to understand membrane integration and substrate interactions.

Combining these methods with site-directed mutagenesis studies of key residues identified in the arm and head domains would provide comprehensive structural-functional relationships.

How does lgt contribute to N. meningitidis virulence and pathogenesis?

As the enzyme responsible for the first step in bacterial lipoprotein maturation, lgt plays a crucial role in N. meningitidis pathogenesis through multiple mechanisms:

• Lipoprotein functionality: Proper lipidation is essential for the correct localization and function of numerous bacterial lipoproteins involved in nutrient acquisition, stress response, and host-pathogen interactions.

• Membrane integrity: lgt activity contributes to outer membrane organization and stability, critical for bacterial survival in different host environments.

• Immune modulation: Bacterial lipoproteins processed by lgt are potent activators of Toll-like receptor 2 (TLR2), influencing host immune responses during infection.

N. meningitidis expresses numerous virulence factors that enable it to interact with diverse microenvironments within the host, during both asymptomatic nasopharyngeal colonization and invasive disease . Many of these interactions involve glycans and lipoproteins whose processing depends on lgt activity.

Is lgt a viable target for antimicrobial development?

Lgt represents a promising antimicrobial target for several reasons:

• Essential function: Lgt activity is critical for bacterial viability in many pathogens.

• Conservation: The enzyme is highly conserved across bacterial species but absent in humans.

• Surface accessibility: As a membrane protein, it may be more accessible to inhibitors than cytoplasmic targets.

Potential therapeutic approaches include:

Importantly, targeting lgt would potentially disrupt multiple virulence mechanisms simultaneously, making resistance development less likely compared to single-target antibiotics.

How does lgt activity influence host-pathogen interactions during meningococcal infection?

N. meningitidis interacts with host cells through multiple mechanisms, many involving bacterial glycans and surface structures dependent on proper lipoprotein processing. Studies with wild-type MC58 strain demonstrated binding to 223 different host glycans, including blood group antigens, mucins, gangliosides, and glycosaminoglycans . This extensive glycointeractome facilitates both colonization and invasion. Lgt activity ensures proper processing of adhesins and other surface proteins that mediate these interactions. The recently discovered high-affinity glycan-glycan interaction between L3 LOS and Thomsen–Friedenreich (TF) antigen (KD of 13 nM) represents one example of the molecular interactions that may be influenced by proper lipoprotein processing .

How can CRISPR-Cas9 genome editing be optimized for studying lgt function in N. meningitidis?

Implementing CRISPR-Cas9 for studying lgt in N. meningitidis requires specialized approaches:

• Vector selection: Adapt meningococcal-compatible plasmids to express Cas9 and the guide RNA.

• sgRNA design: Target unique sequences within lgt while avoiding potential off-target effects. Multiple bioinformatic tools can help design highly specific guides:

  • Critical parameters include GC content (40-60% optimal)

  • Minimizing homology to other genomic regions

  • Selecting target sites within the first half of the coding sequence

• Transformation considerations:

  • Use naturally competent N. meningitidis cells

  • Include homology-directed repair templates for precise modifications

  • Employ methylated DNA to avoid restriction by endogenous systems

• Validation strategies:

  • Sanger sequencing of edited regions

  • RT-qPCR to confirm expression changes

  • Western blotting to verify protein alterations

  • Phenotypic assays to assess functional consequences

Given the likely essential nature of lgt, conditional approaches such as inducible expression systems or partial knockdowns may be required to study its function without compromising cell viability.

What proteomics approaches are most informative for studying the lgt-dependent lipoproteome?

Comprehensive analysis of the N. meningitidis lipoproteome requires specialized proteomics workflows:

• Lipoprotein enrichment methods:

  • Triton X-114 phase partitioning to isolate membrane-associated proteins

  • Metabolic labeling with azide-modified fatty acids followed by click chemistry

  • Immunoprecipitation using anti-lipoprotein antibodies

• Mass spectrometry workflows:

  • Targeted lipidomics to identify specific lipid modifications

  • Bottom-up proteomics for protein identification

  • Top-down proteomics for intact protein analysis with modifications

• Comparative analysis strategies:

  • Wild-type vs. lgt conditional mutants

  • Different growth conditions to identify regulated lipoproteins

  • Cross-species comparison with other Neisseria strains or pathogens

• Bioinformatic prediction and validation:

  • Combined use of algorithms like LipoP, PRED-LIPO, and LipPred

  • Experimental validation of predicted lipoproteins

These approaches can identify the complete set of proteins dependent on lgt for proper processing and localization, providing insights into its role in bacterial physiology and pathogenesis.

How do structural variations in lgt affect substrate specificity across different bacterial species?

Recent research has revealed that the arm and head domains of lgt, particularly in conjunction with histidine 103, determine protein substrate specificity . Comparative structural analysis approaches to investigate these variations include:

• Phylogenetic analysis of lgt sequences across bacterial species to identify:

  • Conserved catalytic residues

  • Variable regions potentially involved in substrate recognition

  • Species-specific insertions or deletions

• Homology modeling based on available structural templates, highlighting:

  • Differences in surface electrostatic potential

  • Variations in substrate-binding pocket architecture

  • Alternative membrane insertion topologies

• Domain swapping experiments involving:

  • Creating chimeric enzymes with domains from different species

  • Measuring activity against various prolipoprotein substrates

  • Correlating structural features with substrate preferences

• Molecular dynamics simulations to examine:

  • Conformational flexibility of substrate-binding regions

  • Interaction energetics with different signal peptides

  • Membrane-dependent functional modulation

These approaches would provide valuable insights into how evolutionary adaptations in lgt structure contribute to species-specific lipoprotein processing profiles.

What strategies can overcome low expression yields of recombinant lgt?

Membrane proteins like lgt often present expression challenges. The following approaches can improve yields:

• Optimization of expression constructs:

  • Testing different affinity tags (His6, GST, MBP) and their positions

  • Including fusion partners that enhance solubility

  • Codon optimization for the expression host

  • Using synthetic genes with optimized GC content

• Expression condition screening:

  • Systematically varying induction temperature (15-30°C)

  • Testing different inducer concentrations (0.1-1.0 mM IPTG)

  • Exploring various media formulations (TB, 2xYT, auto-induction)

  • Adjusting expression duration (4-48 hours)

• Alternative expression systems:

  • Cell-free synthesis systems with supplied lipids/detergents

  • Specialized hosts like C41/C43 E. coli or Lemo21(DE3)

  • Bacillus or Pseudomonas-based expression platforms

• Co-expression strategies:

  • Including chaperones (GroEL/GroES, DnaK/DnaJ)

  • Co-expressing with interacting partners

Systematic optimization using these approaches can significantly improve recombinant lgt yields while maintaining functional integrity.

How can researchers distinguish between specific and non-specific effects in lgt inhibition studies?

When evaluating potential lgt inhibitors, multiple control experiments are essential:

• Biochemical controls:

  • Dose-response relationships to establish IC50 values

  • Enzyme kinetics to determine inhibition mechanisms (competitive, non-competitive)

  • Counter-screening against related enzymes to assess specificity

  • Testing against mammalian enzymes to evaluate selectivity

• Cellular validation approaches:

  • Correlation between biochemical potency and cellular effects

  • Rescue experiments with overexpressed lgt or resistant variants

  • Proteomic profiling to confirm specific effects on lipoprotein processing

  • Monitoring bacterial membrane integrity to exclude general membrane disruption

• Genetic complementation:

  • Parallel testing in wild-type and lgt-depleted strains

  • Introduction of point mutations conferring resistance

  • Heterologous expression of lgt from other species

These multifaceted approaches ensure that observed effects are specifically due to lgt inhibition rather than off-target activities or general toxicity.

What emerging technologies could advance our understanding of lgt function and regulation?

Several cutting-edge technologies hold promise for deeper insights into lgt biology:

• Single-molecule techniques:

  • Fluorescence resonance energy transfer (FRET) to study conformational changes

  • Optical tweezers to investigate mechanical properties of lgt-membrane interactions

  • Single-molecule tracking to monitor lgt dynamics in living cells

• Advanced imaging approaches:

  • Super-resolution microscopy to visualize lgt localization patterns

  • Correlative light and electron microscopy for structural context

  • Expansion microscopy for enhanced spatial resolution

• Systems biology integration:

  • Multi-omics approaches combining transcriptomics, proteomics, and lipidomics

  • Network analysis to position lgt in bacterial physiological pathways

  • Machine learning for prediction of lgt substrates and regulators

• Synthetic biology applications:

  • Creation of minimal lipidation systems in artificial cells

  • Development of orthogonal lipidation machinery for biotechnology

  • Engineering lgt variants with novel substrate specificities

These approaches would provide unprecedented insights into the fundamental biology of bacterial lipoprotein processing and open new avenues for therapeutic intervention.

How might comparative genomics inform our understanding of lgt evolution and specialization?

Comparative genomics approaches can reveal evolutionary patterns in lgt adaptation:

• Pan-genome analysis across Neisseria species and strains to:

  • Identify core vs. accessory lgt genetic elements

  • Detect horizontal gene transfer events

  • Map evolutionary pressure through selection analysis

• Structural genomics integration to:

  • Correlate sequence variations with structural adaptations

  • Identify co-evolving residues through statistical coupling analysis

  • Model the evolutionary trajectory of substrate specificity

• Host-pathogen co-evolution studies exploring:

  • Adaptations of lgt in response to host immune pressure

  • Correlation with host range and tissue tropism

  • Pathogen-specific optimizations for niche colonization