Recombinant Neisseria meningitidis serogroup A / serotype 4A Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Vaccine Development

Although crcB itself is not a current vaccine target, recombinant meningococcal proteins like transferrin-binding proteins (Tbps) and factor H-binding protein (fHbp) have shown promise in eliciting protective immunity . crcB’s role in metabolic adaptation suggests it could serve as an adjuvant or biomarker for vaccine efficacy studies.

Diagnostic Tools

CrcB is used in ELISA kits to detect meningococcal antibodies, leveraging its immunogenic properties. For example:

  • Commercial crcB proteins are sold at ~€1,461 per 50 µg, with purity >90% .

  • Cross-reactivity studies with serogroup C crcB indicate potential for pan-meningococcal diagnostic assays .

Comparative Analysis of Serogroup-Specific Variants

The crcB homologs across N. meningitidis serogroups exhibit structural conservation but serotype-specific variations:

FeatureSerogroup A (4A)Serogroup C
StrainZ2491Unspecified clinical isolate
AA SubstitutionsNoneM17L, L45F
Gene LocusNMA1264NMCC_0983
Expression HostE. coliE. coli

These differences may influence antigenicity or transporter efficiency .

Practical Considerations for Use

  • Storage Stability: Repeated freeze-thaw cycles degrade crcB; aliquots stored at -80°C retain functionality for >1 year .

  • Reconstitution: Optimized in Tris/PBS buffers with 6% trehalose to prevent aggregation .

Future Research Directions

  • Mechanistic Studies: Clarify crcB’s role in fluoride resistance and metabolic interplay with HexR .

  • Immunogenicity Profiling: Test crcB as a vaccine component in combination with capsular polysaccharides (e.g., serogroup A’s unique α-1,6–linked N-acetyl mannosamine-1-phosphate capsule) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; NMA1264; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
crcB
Target Protein Sequence
MLSNIIPLSIGAALGATARWLLNLAVPASLSPATGNLFANWTGAFLIGIFAETVNHPQWK LLLITGFLGSLTTLSGFSLETVTLLQSNRPASALANIFLHTAGSLLLTWLGLKIGTAVK
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links

KEGG: nma:NMA1264

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of CrcB homolog in Neisseria meningitidis?

The CrcB homolog in N. meningitidis is believed to function primarily in fluoride ion transport across the bacterial membrane, playing a role in maintaining ion homeostasis. While specific characterization in N. meningitidis remains limited, comparisons with other bacterial species suggest it contributes to fluoride resistance mechanisms. Research indicates that membrane proteins like CrcB often function within regulatory networks that respond to environmental signals, similar to how the HexR regulator controls metabolic genes in N. meningitidis in response to glucose . Expression analysis typically shows upregulation under specific ionic stress conditions, suggesting an adaptive function during infection processes.

How can I clone and express the crcB gene from N. meningitidis?

Cloning and expressing the crcB gene follows established molecular biology protocols for membrane proteins:

  • Design PCR primers incorporating appropriate restriction sites (like NdeI at the start codon and BamHI after the stop codon, as demonstrated for tbpA in N. meningitidis)

  • Amplify the crcB gene using high-fidelity DNA polymerase from purified N. meningitidis genomic DNA (strain-specific approaches may be required)

  • Clone the PCR product into an expression vector system such as the pMTL vector series, which has been successfully used for N. meningitidis proteins

  • Transform into an E. coli expression system optimized for membrane proteins (C41 or C43 strains may improve expression)

  • Induce expression under optimized conditions (temperature, IPTG concentration, duration)

For membrane proteins like CrcB, expression with a fusion tag (such as His6) at the C-terminus often improves purification outcomes while maintaining protein function.

What are the common challenges in purifying recombinant CrcB protein?

Purification of recombinant CrcB presents several technical challenges:

  • Membrane protein solubilization: Requires careful optimization of detergent type and concentration. Initial screening with a panel of detergents (DDM, LDAO, OG) at varying concentrations is recommended.

  • Protein stability: CrcB tends to aggregate during concentration steps. Adding glycerol (10-15%) and maintaining low temperatures throughout purification improves stability.

  • Functional conformation: Ensuring the purified protein retains its native conformation requires monitoring using circular dichroism spectroscopy.

  • Contamination with endotoxins: When purifying for immunization studies, additional purification steps such as Triton X-114 phase separation may be necessary, similar to methods used for TbpA and TbpB proteins from N. meningitidis .

  • Yield optimization: Expression levels can be improved by optimizing codon usage for E. coli and using specialized host strains for membrane protein expression.

How can I verify the expression and function of recombinant CrcB protein?

Verification requires a multi-pronged approach:

  • Expression confirmation:

    • Western blot analysis using anti-His antibodies (if His-tagged)

    • Mass spectrometry analysis of protein bands from SDS-PAGE

    • N-terminal sequencing to confirm protein identity

  • Functional validation:

    • Ion transport assays measuring fluoride uptake/efflux

    • Growth complementation assays in CrcB-deficient bacterial strains

    • Membrane localization confirmation using subcellular fractionation

  • Structural integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate protein folding

    • Thermal shift assays to determine protein stability

Similar approaches have been successfully employed for other N. meningitidis membrane proteins, where functional verification often involves demonstrating specific binding activity, as was done with recombinant TbpA and TbpB proteins that retained human transferrin binding activity .

What are appropriate expression systems for recombinant N. meningitidis CrcB production?

Expression SystemAdvantagesDisadvantagesOptimal Conditions
E. coli BL21(DE3)High yield, ease of use, low costMay not produce properly folded membrane proteinsIPTG 0.1-0.5 mM, 18-25°C, 16h
E. coli C41/C43Specialized for membrane proteins, reduced toxicityLower yields than BL21IPTG 0.05-0.2 mM, 16-20°C, 20h
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesHigh cost, lower yieldSpecialized commercial kits required
N. meningitidis expressionNative processing and foldingComplex cultivation, safety concernsRequires specialized facilities
Pseudomonas-based systemsBetter for membrane proteins, similar GC contentComplex media requirementsStrain-specific optimization required

Expression in E. coli can be optimized by creating a fusion construct with a leader sequence, similar to the approach used for TbpB where the rlpB sequence was fused to tbpB to facilitate expression and processing .

How do I design experiments to study CrcB protein interactions with metabolic regulators?

To investigate potential interactions between CrcB and metabolic regulators (such as HexR):

  • Co-immunoprecipitation studies:

    • Express epitope-tagged versions of both proteins

    • Perform pull-down assays under various metabolic conditions

    • Include appropriate controls for non-specific binding

  • Bacterial two-hybrid analysis:

    • Clone crcB and potential interaction partners into two-hybrid vectors

    • Measure reporter gene expression to quantify interactions

    • Include positive and negative controls to validate results

  • Transcriptional analysis:

    • Perform qRT-PCR to measure expression changes in crcB upon deletion of regulatory genes

    • Use methods similar to those described for analyzing gene expression in N. meningitidis, including reverse transcription with random hexamers followed by qPCR

    • Analysis using the comparative cycle threshold (ΔCt) method

  • Chromatin immunoprecipitation:

    • Identify potential binding of transcriptional regulators to the crcB promoter

    • Map binding sites through sequencing of precipitated DNA

    • Compare with known binding motifs such as the 17-bp pseudopalindromic consensus HexR binding motif

How does glucose availability affect CrcB expression in N. meningitidis?

While the direct relationship between glucose and CrcB expression requires specific investigation, parallels can be drawn from the glucose-responsive regulation seen with other N. meningitidis genes:

  • The HexR transcriptional regulator in N. meningitidis controls central carbon metabolism genes in response to glucose availability . Similar regulatory mechanisms may influence CrcB expression if it participates in metabolic adaptation.

  • For experimental design, researchers should consider:

    • Cultivating N. meningitidis under varying glucose concentrations (0-10 mM), reflecting physiological ranges found in human blood (approximately 4 mM)

    • Monitoring crcB expression using qRT-PCR with gene-specific primers

    • Performing comparative transcriptomics between wild-type and regulatory mutants (e.g., hexR deletion strains)

    • Analyzing protein levels via western blotting with CrcB-specific antibodies

  • Data interpretation should account for growth phase effects, as the glucose response may vary between logarithmic and stationary phases of bacterial growth.

What methods are effective for developing CrcB knockout mutants in N. meningitidis?

Creating crcB knockout mutants requires specialized techniques for the genetic manipulation of N. meningitidis:

  • Cassette replacement strategy:

    • Construct a plasmid containing antibiotic resistance markers (e.g., kanamycin) flanked by regions homologous to sequences upstream and downstream of crcB

    • Transform into naturally competent N. meningitidis strains

    • Select transformants using appropriate antibiotics

    • Confirm gene replacement by PCR and sequencing

  • CRISPR-Cas9 approach:

    • Design guide RNAs targeting crcB sequence

    • Introduce CRISPR-Cas9 system and guide RNAs into N. meningitidis

    • Screen for successful editing events

    • Validate mutations through sequencing

  • Transposon mutagenesis:

    • Use transposon systems optimized for N. meningitidis

    • Screen for insertions in crcB

    • Confirm insertions through sequencing and phenotype analysis

Verification of knockout strains should include RT-PCR to confirm absence of transcription, as well as functional assays to assess phenotypic changes. Selection methods can use both positive selection (kanamycin resistance) and negative selection (streptomycin susceptibility) approaches, similar to methods described for other bacterial systems .

How can I assess the impact of CrcB on N. meningitidis virulence in animal models?

Assessment of CrcB's role in virulence requires careful experimental design:

  • Animal model selection:

    • Infant rat model (successfully used for hexR mutant evaluation)

    • Mouse intranasal or intraperitoneal challenge models

    • Ex vivo human cell culture systems as preliminary screens

  • Experimental design considerations:

    • Compare wild-type, crcB knockout, and complemented strains

    • Monitor bacterial loads in blood and cerebrospinal fluid at regular intervals

    • Assess survival rates and inflammatory responses

    • Measure competitive index when wild-type and mutant strains are co-inoculated

  • Data collection parameters:

    • Bacterial CFU/ml in relevant tissues and fluids

    • Proinflammatory cytokine profiles

    • Host survival curves

    • Tissue pathology scoring

  • Controls and validations:

    • Include established virulence-attenuated control strains

    • Confirm stability of the mutation during infection

    • Verify expression of complemented gene in vivo

Similar approaches successfully demonstrated that N. meningitidis strains lacking hexR expression were deficient in establishing bacteremia in an infant rat model, indicating the importance of metabolic regulators for survival in vivo .

How do I analyze cross-reactivity patterns of antibodies against CrcB across different N. meningitidis strains?

Cross-reactivity analysis requires systematic evaluation:

  • Strain selection:

    • Include representatives from major serogroups (A, B, C, W, Y, X)

    • Consider geographical and temporal diversity

    • Include strains with sequence variations in crcB

  • Methods for cross-reactivity assessment:

    • Whole-cell ELISA using standardized bacterial preparations

    • Western blotting against whole-cell lysates and membrane fractions

    • Flow cytometry with intact bacteria to assess surface accessibility

  • Data analysis approach:

    • Calculate relative binding ratios compared to the immunizing strain

    • Generate heat maps of cross-reactivity patterns

    • Correlate with CrcB sequence variations

  • Presentation format:

Meningococcal StrainSerogroupELISA Titer Against Anti-CrcBWestern Blot Signal IntensityFlow Cytometry (MFI)
Strain 1A12,500+++1450
Strain 2B8,300++980
Strain 3C5,600+650
Strain 4W7,200++840

Similar cross-reactivity analyses have been performed for Transferrin Binding Proteins in N. meningitidis, where whole-cell ELISA titers were used to assess the breadth of antibody responses against different meningococcal strains and serotypes .

What statistical approaches are appropriate for analyzing differential expression of crcB under various environmental conditions?

Statistical analysis should be rigorous and appropriate for the experimental design:

  • For qRT-PCR data:

    • Apply the comparative cycle threshold (ΔCt) method to normalize expression data

    • Use paired t-tests for direct comparisons between two conditions

    • Apply ANOVA with post-hoc tests for multiple condition comparisons

    • Calculate fold changes with 95% confidence intervals

  • For RNA-seq analysis:

    • Normalize read counts appropriately (RPKM/FPKM/TPM)

    • Apply DESeq2 or edgeR for differential expression analysis

    • Use false discovery rate correction for multiple testing

    • Set significance thresholds (typically adjusted p < 0.05 and fold change > 2)

  • For microarray data:

    • Apply robust multi-array averaging (RMA) normalization

    • Use moderated t-statistics (limma package) for differential expression

    • Incorporate batch effect correction where necessary

  • Validation approaches:

    • Confirm key findings with alternative methods (e.g., validate RNA-seq with qRT-PCR)

    • Include biological replicates (minimum n=3) for statistical power

    • Perform power analysis to determine appropriate sample sizes

This approach aligns with methods used in transcriptomic experiments for N. meningitidis, where RNA samples were analyzed using microarrays followed by qRT-PCR validation .

How might CrcB function intersect with meningococcal vaccine development strategies?

The potential role of CrcB in vaccine development warrants investigation:

  • CrcB as a vaccine antigen:

    • Assess conservation across diverse meningococcal strains

    • Determine surface accessibility through proteomic approaches

    • Evaluate immunogenicity in animal models

    • Compare protection breadth with established vaccine candidates

  • Combination strategies:

    • Test CrcB in combination with other promising antigens such as TbpA and TbpB, which have demonstrated protection in mouse infection models

    • Evaluate synergistic protection when combined with capsular polysaccharide conjugates

  • Adjuvant optimization:

    • Determine optimal adjuvant formulations for membrane protein antigens

    • Measure both humoral and cellular immune responses

    • Assess mucosal immunity development

  • Implementation considerations:

    • Address heterogeneity concerns through conserved epitope targeting

    • Evaluate manufacturing scalability for membrane proteins

    • Assess stability in various formulation conditions

While TbpB has been identified as a promising vaccine candidate that elicits bactericidal antibody responses, TbpA has traditionally been considered a poor vaccine antigen due to conformation-dependent antibody recognition . Similar structural and immunological studies with CrcB would be necessary to determine its vaccine potential.

What techniques can I use to investigate CrcB protein structure-function relationships?

Advanced structure-function studies require specialized approaches:

  • Structural analysis methods:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for higher-resolution structural data

    • NMR spectroscopy for dynamic information

    • Molecular dynamics simulations to predict functional movements

  • Site-directed mutagenesis approach:

    • Identify conserved residues through sequence alignment

    • Create point mutations targeting predicted functional regions

    • Develop a systematic alanine-scanning mutagenesis program

    • Assess mutant phenotypes through transport assays

  • Protein-lipid interactions:

    • Lipid binding assays to identify specific interactions

    • Reconstitution into liposomes of varying composition

    • Assess protein stability and function in different membrane environments

  • In silico prediction tools:

    • Homology modeling based on related bacterial transporters

    • Ligand docking simulations to predict binding sites

    • Electrostatic surface mapping to identify potential ion channels

Understanding structure-function relationships will provide insights into how CrcB contributes to meningococcal physiology and potentially identify inhibitory strategies that could complement vaccine approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.