Recombinant Neisseria meningitidis serogroup A / serotype 4A Putative zinc metalloprotease NMA0084 (NMA0084)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
NMA0084; Putative zinc metalloprotease NMA0084
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
NMA0084
Target Protein Sequence
MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFFTRKRGDTEWCLAPIP LGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGVT ELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADWGSAQTEIVLNLEAGKVAVGVQTA SGAQTVRTIDAAGTPEAGKIAKNQGYIGLMPFKITTVAGGVEKGSPAEKAGLKPGDRLTA ADGKPIASWQEWANLTRQSPGKKITLTYERAGQTHTADIRPDTVEQPDHTLIGRVGLRPQ PDRAWDAQIRRSYRPSVVRAFGMGWEKTVSHSWTTLKFFGKLISGNASVSHISGPLTIAD IAGQSAELGLQSYLEFLALVSISLGVLNLLPVPVLDGGHLVFYTAEWIRGKPLGERVQNI GLRFGLALMMLMMAVAFFNDVTRLLG
Uniprot No.

Target Background

Database Links

KEGG: nma:NMA0084

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NMA0084 in Neisseria meningitidis?

NMA0084 is hypothesized to play a role in protein processing during N. meningitidis infection and survival. As a putative zinc metalloprotease, it may be involved in:

  • Proteolytic processing of host or bacterial proteins

  • Modulation of the bacterial response to zinc availability

  • Contribution to virulence by degrading host immune factors

  • Involvement in bacterial adaptation to environmental conditions during infection

While its exact physiological function remains under investigation, transcriptomic studies have shown that zinc-related genes in N. meningitidis are dynamically regulated during infection, suggesting a role in adaptation to host environments . The zinc-responsive regulon in N. meningitidis comprises multiple genes, and metalloproteases like NMA0084 may be part of this response network for bacterial survival during zinc limitation or excess .

What expression systems are most effective for producing recombinant NMA0084?

Recombinant NMA0084 has been successfully expressed in several systems, with E. coli being the most commonly used. Based on existing protocols:

Recommended expression systems and conditions:

  • E. coli expression system:

    • Expression vector: pET system with N-terminal His-tag

    • Host strain: BL21(DE3) or Rosetta for rare codon optimization

    • Induction: 0.5-1.0 mM IPTG at OD₆₀₀ of 0.6-0.8

    • Temperature: 16-18°C post-induction (to minimize inclusion body formation)

    • Duration: 16-20 hours

  • Alternative systems when E. coli yields insoluble protein:

    • Yeast expression systems (Pichia pastoris)

    • Baculovirus expression system

    • Mammalian cell expression

When designing expression constructs, consider:

  • Including solubility enhancers like MBP fusion tags

  • Expressing functional domains separately if full-length protein proves difficult

  • Codon optimization for the selected expression system

The choice between expression systems should be guided by downstream applications and required protein characteristics .

What purification strategies yield the highest purity and activity for recombinant NMA0084?

The purification strategy for recombinant NMA0084 typically follows a multi-step process:

Recommended purification protocol:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Buffer composition: 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Imidazole gradient: 20-250 mM

  • Intermediate purification:

    • Ion exchange chromatography (IEX)

    • Size exclusion chromatography (SEC)

  • Polishing and contaminant removal:

    • Second IMAC step or affinity tag removal

    • Final SEC in activity buffer

Critical considerations for maintaining activity:

  • Include zinc ions (5-10 μM ZnCl₂) in all buffers to maintain metalloprotease activity

  • Avoid EDTA and other chelating agents that will strip essential zinc ions

  • Include reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidation

  • Maintain protein at 4°C during purification

  • Storage buffer should contain 10-50% glycerol for stability during freezing

Typical yields range from 1-5 mg per liter of bacterial culture for soluble, active protein.

How can researchers validate the structural integrity and enzymatic activity of purified recombinant NMA0084?

Validating both the structural integrity and enzymatic activity of purified NMA0084 requires multiple complementary approaches:

Structural validation methods:

  • SDS-PAGE and Western blotting:

    • Expected molecular weight: ~49 kDa for the full-length protein

    • Antibody detection: anti-His tag or specific antibodies against NMA0084

  • Mass spectrometry characterization:

    • Intact mass analysis for confirmation of full-length protein

    • Peptide mapping to confirm sequence coverage

  • Circular dichroism (CD) spectroscopy:

    • Secondary structure analysis

    • Thermal stability assessment

Enzymatic activity assays:

  • Generic metalloprotease activity assays:

    • Fluorogenic peptide substrates (e.g., FRET-based substrates)

    • Casein zymography

  • Metal content analysis:

    • Inductively coupled plasma mass spectrometry (ICP-MS) to confirm zinc coordination

    • Activity dependence on zinc concentration (5-10 mM Mn²⁺ provides optimal conditions)

  • Inhibition profile:

    • EDTA and 1,10-phenanthroline should inhibit activity

    • Specific metalloprotease inhibitors can establish inhibition profile

Important control experiments:

  • Site-directed mutagenesis of putative catalytic residues to confirm enzymatic mechanism

  • Parallel testing with commercially available metalloproteases as positive controls

  • Testing activity in the presence and absence of zinc/manganese to confirm metal dependence

What are the key considerations for designing experiments to study NMA0084 function in vitro?

When designing experiments to study NMA0084 function in vitro, researchers should consider:

Experimental design framework:

  • Hypothesis formulation:

    • Clearly define testable hypotheses about NMA0084 function

    • Consider potential substrates based on predicted localization and bacterial lifecycle

  • Control selection:

    • Include catalytically inactive mutants (e.g., mutation in zinc-binding motif)

    • Use related metalloproteases as positive controls

    • Include no-enzyme and no-substrate controls

  • Variable manipulation:

    • Independent variable: enzyme concentration, substrate concentration, pH, temperature

    • Dependent variable: substrate cleavage, product formation

    • Control variables: buffer composition, incubation time

Methodological approach:

  • Begin with biochemical characterization (substrate specificity, kinetics)

  • Progress to cellular models assessing effects on host cells

  • Design experiments with appropriate statistical power (minimum n=3)

  • Include time-course analyses to determine optimal reaction conditions

Potential pitfalls to avoid:

  • Using inappropriate buffers that chelate zinc

  • Failing to account for potential autoproteolysis

  • Ignoring the role of potential cofactors or activators

How should researchers approach studying NMA0084 in the context of host-pathogen interactions?

To study NMA0084 in the context of host-pathogen interactions, researchers should design comprehensive experimental approaches:

Recommended in vitro host-pathogen models:

  • Cell culture models:

    • Human brain microvascular endothelial cells (hBMECs) to study meningeal invasion

    • Primary human neutrophils to assess interactions with immune cells

    • Human whole blood ex vivo model to simulate bacteremia

  • Experimental approach:

    • Comparative studies:

      • Wild-type N. meningitidis vs. NMA0084 deletion mutants

      • Complementation with wild-type and catalytically inactive versions

    • Analysis methods:

      • Adhesion and invasion assays

      • Transcriptome analysis of host and bacterial responses

      • Proteomics to identify processed substrates

      • Cytokine/chemokine profiling to assess immune responses

  • Critical controls:

    • Use of multiple bacterial strains to account for strain variation

    • Inclusion of unrelated metalloprotease mutants as controls

    • Careful documentation of experimental conditions as transcriptional responses are highly sensitive to environmental factors

Data interpretation framework:

  • Correlate NMA0084 activity with specific aspects of bacterial pathogenesis

  • Consider both direct effects (substrate processing) and indirect effects (signaling alterations)

  • Integrate findings with existing knowledge of meningococcal virulence factors

What experimental designs are most appropriate for determining the in vivo role of NMA0084?

Determining the in vivo role of NMA0084 presents challenges due to the human-specific nature of N. meningitidis infection. Researchers should consider:

Experimental design considerations:

  • Transgenic humanized mouse models:

    • Mice expressing human transferrin receptor

    • Mice expressing human complement regulators

    • Design should include appropriate power calculations and randomization

  • Infection models:

    • Intraperitoneal infection to assess systemic spread

    • Intranasal challenge to assess nasopharyngeal colonization

    • Direct cerebral inoculation models for CNS infection

  • Experimental groups:

    • Wild-type N. meningitidis

    • NMA0084 deletion mutant

    • Complemented strains (wild-type and catalytically inactive)

    • Uninfected controls

  • Outcome measures:

    • Bacterial loads in blood and CSF

    • Inflammatory markers

    • Blood-brain barrier integrity

    • Histopathological changes

    • Survival analysis

Ethics and alternatives:

  • Consider 3Rs principles (Replacement, Reduction, Refinement)

  • Ex vivo tissue models may provide alternatives to animal studies

  • Consult institutional ethics committees early in planning

  • Follow NIH guidelines for recombinant organism research

How does zinc availability regulate the expression and activity of NMA0084 during infection?

The regulation of zinc metalloproteases like NMA0084 by zinc availability represents a complex adaptation mechanism:

Current understanding of zinc regulation in Neisseria:

  • Transcriptional regulation:

    • The zinc uptake regulator (Zur) acts as a repressor under zinc-replete conditions

    • In zinc-limited environments, Zur repression is lifted, allowing transcription

    • Zur-regulated genes contain a conserved Zur binding motif (Zur box) with the consensus sequence TGTTATDNHATAACA

  • Zinc homeostasis mechanisms:

    • N. meningitidis expresses systems for both zinc acquisition and export

    • TdfH/CbpA functions to acquire zinc from calprotectin during nutritional immunity

    • ZnuD functions as a zinc-specific transporter

Experimental approaches to study NMA0084 regulation:

  • Transcriptional analysis:

    • qRT-PCR to measure NMA0084 expression under varying zinc concentrations

    • RNA-seq to identify co-regulated genes

    • ChIP-seq to identify Zur binding sites in the NMA0084 promoter region

  • Protein expression and activity analysis:

    • Western blotting to measure NMA0084 protein levels

    • Activity assays to correlate enzyme function with zinc availability

    • Metal content analysis to determine zinc occupancy

  • Host factor influence:

    • Assess effects of calprotectin and S100A7 (host zinc-sequestering proteins)

    • Analyze NMA0084 expression in neutrophil-rich vs. neutrophil-depleted environments

Data interpretation framework:

  • Integrate NMA0084 regulation data with broader zinc regulon response

  • Consider both transcriptional and post-translational regulatory mechanisms

  • Analyze regulation in context of host nutritional immunity strategies

What is the role of NMA0084 in Neisseria meningitidis virulence and pathogenesis?

Understanding NMA0084's role in virulence requires integration of multiple experimental approaches:

Current hypotheses regarding NMA0084 function in pathogenesis:

  • Potential substrates and mechanisms:

    • Processing of bacterial surface proteins for evasion of host immunity

    • Degradation of host immune effectors

    • Modulation of bacterial adhesion and invasion capacity

    • Contribution to blood-brain barrier penetration

  • Transcriptome evidence:

    • Studies of N. meningitidis in human whole blood show complex transcriptional responses

    • Zinc-related genes show dynamic regulation during infection

    • Surface-exposed proteins are significantly regulated during adaptation to blood

Experimental approaches to define virulence contributions:

  • Comparative genomics and transcriptomics:

    • Compare NMA0084 conservation and expression across invasive vs. carriage isolates

    • Correlate expression with disease outcome data

  • Virulence factor interaction studies:

    • Assess whether NMA0084 processes other known virulence factors

    • Determine if NMA0084 interacts with zinc uptake systems (ZnuD, TdfH)

  • Blood-CSF barrier studies:

    • Evaluate the role of NMA0084 in interactions with brain endothelial cells

    • Compare wild-type and NMA0084 mutants for their ability to cross in vitro models

Research implications:

  • NMA0084 may represent a potential therapeutic target

  • Characterization may reveal new mechanisms of meningococcal pathogenesis

  • Findings could inform vaccine development strategies

How does the structure-function relationship of NMA0084 compare to other bacterial zinc metalloproteases?

Understanding the structure-function relationship of NMA0084 requires comparative analysis with related metalloproteases:

Structural characteristics of bacterial zinc metalloproteases:

  • Conserved domains and motifs:

    • HEXXH zinc-binding motif is characteristic of zinc metalloproteases

    • Differences in surrounding residues influence substrate specificity

    • Secondary coordination sphere residues modulate activity and zinc affinity

  • Structural comparison with related enzymes:

    • Thermolysin-like metalloproteases share similar catalytic mechanisms

    • M48 family proteases function as membrane-embedded quality control proteases

    • RIP (regulated intramembrane proteolysis) metalloproteases cleave substrates within membranes

Experimental approaches for structure-function analysis:

  • Structural determination methods:

    • X-ray crystallography of soluble domains

    • Cryo-EM for membrane-embedded full-length protein

    • Molecular modeling and dynamics simulations

  • Structure-guided mutagenesis:

    • Systematic mutation of putative catalytic residues

    • Analysis of substrate-binding pocket residues

    • Investigation of metal coordination geometry

  • Activity correlation studies:

    • Measure activity changes resulting from targeted mutations

    • Assess substrate specificity alterations

    • Determine structural requirements for zinc binding

Comparative framework:

  • Compare NMA0084 with zinc metalloproteases from other bacterial pathogens

  • Identify unique structural features that could be exploited for specific inhibition

  • Correlate structural elements with specific functions in the bacterial lifecycle

What NIH guidelines apply to research involving recombinant Neisseria meningitidis proteins like NMA0084?

Research involving recombinant N. meningitidis proteins is subject to specific regulatory guidelines:

NIH Guidelines applicable to NMA0084 research:

  • Recombinant DNA classification:

    • Work with recombinant NMA0084 expressed in E. coli K-12 with standard cloning vectors falls under Section III-F if it contains less than 50% of a pathogen genome

    • If using the full-length gene in expression systems, work may be classified under Section III-D-2 (Inserting nucleic acids from Risk Group 2 pathogens into prokaryotic cells)

  • Containment requirements:

    • Research typically requires Biosafety Level 2 (BSL-2) practices and facilities

    • Enhanced BSL-2 practices may be required depending on the specific experimental design

    • Work with infectious N. meningitidis requires additional containment measures beyond those for the recombinant protein alone

  • Institutional approval process:

    • Institutional Biosafety Committee (IBC) approval required before initiation

    • Registration of recombinant materials is mandatory, even if obtained from colleagues

    • Principal investigators must assume responsibility for compliance with guidelines

Practical implementation steps:

  • Complete institutional rDNA registration forms

  • Develop detailed SOPs for safe handling and disposal

  • Ensure all personnel receive appropriate training

  • Document compliance with institutional biosafety requirements

How should researchers address biosafety concerns when working with NMA0084?

Working with NMA0084 involves specific biosafety considerations:

Biosafety risk assessment:

  • Potential hazards:

    • Recombinant protein itself presents minimal risk unless combined with delivery vehicles

    • Expression systems may present different risk profiles

    • N. meningitidis is a Risk Group 2 pathogen requiring appropriate containment

  • Exposure routes:

    • Parenteral exposure (needlesticks, cuts)

    • Mucous membrane exposure (splashes to eyes, nose)

    • Aerosol generation during processing (sonication, centrifugation)

  • Mitigation strategies:

    • Use of Biosafety Level 2 practices and facilities

    • Use of biological safety cabinets for procedures with aerosol potential

    • Proper personal protective equipment (gloves, lab coat, eye protection)

    • Vaccination of personnel against meningococcal disease

Emergency response procedures:

  • Develop spill response protocols specific to recombinant materials

  • Establish post-exposure procedures for laboratory personnel

  • Maintain documentation of all incidents and near-misses

What are the key considerations for responsible research using NMA0084 in pathogenesis studies?

Responsible research with NMA0084 requires careful consideration of scientific and ethical factors:

Research integrity considerations:

  • Experimental design principles:

    • Ensure statistical validity through proper power calculations

    • Implement rigorous controls and blinding where appropriate

    • Consider reproducibility from the outset of experimental design

    • Use the minimum number of samples necessary for statistical significance

  • Data management:

    • Establish clear data recording and storage protocols

    • Address potential sources of bias in data collection and analysis

    • Make data available in accordance with FAIR principles (Findable, Accessible, Interoperable, Reusable)

  • Reporting standards:

    • Follow ARRIVE guidelines for animal studies

    • Include detailed methodology sufficient for experimental reproduction

    • Report both positive and negative results

Ethical considerations:

  • Utilize alternative methods to animal models when possible

  • Design studies to maximize information gained while minimizing potential harm

  • Consider dual-use potential of research findings

  • Engage institutional ethics committees early in planning process

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.